KEGG   Eremothecium cymbalariae: Ecym_7122Help
Entry
Ecym_7122         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
erc  Eremothecium cymbalariae
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Ecym_7122
  Replication and repair
   03420 Nucleotide excision repair
    Ecym_7122
Transcription machinery [BR:erc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Ecym_7122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:245683..246882
Genome map
AA seq 399 aa AA seqDB search
MENSPTPISISATRKTASNTFLPLNTKRVSDDDLYRTSTQYKLWSFTSKRLEQIRSDINL
RSSEIIKKQIIQFKESHPNLSTEELEAIDSLAIPLNADEEFKLVNFYARKVQQCASSLNL
PTEVTATAISFFRKFFLTNSVMDIHPKNILLTTIFLACKSENYFIGIESFAQKTKSKEDA
ILKYEFKVLESLKFTLLNHHPFKALHGFFLDIQSILNGKVDLEYMGQVYTNSKKKITDAL
LTDAVYQYTPPQITLAVLLAEDQTLIDRYLELKFPNKNKDNSVDVIKPTSADSTNTTSGS
SSNGNMEVKEVVQSKEVPNEGNETTNDNTNMIDLPKLIKTIQDCRDIIFERQSVTKEEVK
EIDAKLHYCKNPMLVLRRLKRQKDSSSSASPPDIKRQKL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagaactcacctactcctattagcatatctgccacccgcaaaacagcttcgaataca
tttttgccgcttaatacgaagcgggtcagcgatgatgacctttacagaacttcaacccaa
tataagttatggtcttttacatcgaaaaggctcgaacaaataagatcagatataaatctc
cgttcttctgagattattaagaaacaaataattcagtttaaagaatctcatcccaatcta
tcgacagaggaacttgaggccatcgattcattggctatacctttgaatgctgatgaagaa
tttaaacttgttaatttctacgccagaaaggtacaacaatgtgctagctctttgaactta
cctacggaagtgactgcaactgcaatctctttttttaggaagtttttcctcacaaattct
gttatggatattcacccaaagaacatcttgctaactaccatatttctggcgtgcaaatca
gaaaactacttcatcgggattgagtcatttgctcaaaagacgaagtctaaagaagacgct
attctaaaatacgaatttaaggttttggagtctttaaagtttacgctattgaatcatcat
ccgtttaaggccttgcatggcttcttcttagacatccaatccatcttgaacgggaaagtt
gatttagaatatatgggccaagtatatacgaactctaaaaagaaaatcacagatgcatta
ttaacagatgcagtatatcaatatactcccccacagatcactttggcggttttgctggct
gaagatcaaaccctaatagatcgttatttggagttgaagtttccaaataaaaacaaagat
aattcagttgatgtcataaaaccaacttctgctgatagtacaaatactacttcaggaagc
tccagtaatggaaatatggaggtaaaggaagtggtccaatccaaggaagtaccgaatgaa
ggaaacgagactacaaatgataatacaaatatgatcgatttgcctaagttgataaagact
atacaggattgcagagacatcatatttgaacggcaatctgtgacgaaagaagaagtaaaa
gaaatagatgcaaagttacattactgtaagaatccaatgctggtgctccgacgtctcaaa
agacaaaaggattcttcttccagtgcaagcccgccagatattaaaagacaaaagctataa

DBGET integrated database retrieval system