KEGG   Eremothecium cymbalariae: Ecym_7142Help
Entry
Ecym_7142         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
erc  Eremothecium cymbalariae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Ecym_7142
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    Ecym_7142
   04113 Meiosis - yeast
    Ecym_7142
Protein phosphatases and associated proteins [BR:erc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Ecym_7142
Ubiquitin system [BR:erc04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Ecym_7142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(287110..289137)
Genome map
AA seq 675 aa AA seqDB search
MSAVLQETISQLKHLIITHIQQLNYDSAEFFSELLYADCSWINNGSNTGGNTVDDCRDRY
DSLYYYALTLYLQGEYHSSIHVVKDSLRSHLGCAYVYARCCLKLGKHYQEAIQALVVLQD
CWQNGVTNTTDLYMYPDKATILSVLGQLSLKSHQDKESVSFLSQSLSTNSHQLEPLSILF
EMRADLQTVKLFKPVKKSWKSKHLRTSNIISKPQTPFKIPSRLTTSSVAVAPNPLLSTSN
VIVATSPSLMRRSKFLNSSSNTTLTNSSNSNSGSSDSGGNGSNNNNNINNNSNNNNNNNH
NNNNVNNNVQQSTPPSKLLSIDHNKITPEGKTSPSQVQILSHNPVSRRPLDQLLYWMMKA
YKSYYRYDSYRAIRLLNEQLPPHILQSMPWCLSLLSRLHFEIQNHDMALSYFSKLRRLQP
TRLKDMDVYSTLLWHLHDKIRLADLCHELMEQDDKSAITWCCLGNLFSLNRDHDEAIKAL
KKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQ
YDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKS
QLLFNLGQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAMNLDPKG
IQLVKEALEKCHEQG
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgttctgcaggagacaatatcacaactaaagcatttgatcataacccatatt
cagcagttgaactacgattcagcggagttcttctccgaattgttgtatgccgactgctcg
tggatcaacaacggcagcaacacgggtggtaatacagtagatgactgccgggataggtat
gattcgttgtattactatgcattgacgttatatttgcaaggagaatatcattcttctatt
catgttgttaaggattcattgagatctcatctagggtgtgcgtatgtctatgcgagatgt
tgtttaaagcttgggaaacattaccaggaggccattcaagcgttggtggttttgcaggat
tgctggcagaacggtgtgacgaacaccactgatttgtacatgtaccctgataaagcgaca
atattatctgtgttgggccaattatctttaaaatcgcatcaagataaagaatcggttagt
ttcctttcgcagtcgttgtctactaacagccatcagttagagccgctatccatcctattt
gaaatgcgggcagatctccagacagttaaattgttcaaacctgtcaagaagtcgtggaag
tcgaagcatttacgaacatctaatattatttcaaagccgcaaactccgtttaagataccg
tctaggttaacgacatcttcggttgcagttgctccaaatcctttactttctacctccaat
gttatagttgccacttctccgtctctgatgaggcgatctaaatttctaaattcaagtagt
aacaccactttaaccaatagtagcaacagcaatagcggtagcagcgatagcggtggtaac
ggcagtaacaacaacaacaacatcaacaacaacagcaacaataataataataataatcat
aataataataatgttaataataatgtccagcaatctactcctccttcgaaacttctgagt
attgatcataataaaataacgcccgaaggtaaaacttcgccatctcaggttcaaatattg
tcacacaaccctgtttcccggagacctttagatcagttgttatactggatgatgaaagcg
tataaatcatattatcgttatgattcttatagggccattagattattaaatgaacaactt
ccgcctcatattttacaatctatgccttggtgcttatccttattgtctagactacacttt
gagattcagaaccacgatatggcattatcttattttagcaagttgcgtcgcttgcagccc
actagactcaaggacatggatgtttattctactctactatggcatctacatgataaaatt
cgtttagccgatttgtgccatgagttaatggaacaagatgacaaaagtgccattacatgg
tgttgtttaggtaacttgttttctctaaatagagatcatgatgaagccattaaagcatta
aaaaaggctaccaatctcgacccgcggtttgcgtatgcatatactttgcaaggtcatgaa
tactctaataatgatgccttcgataatgctaaaatgtgctaccgcaaagctttggccatt
aaccctaatcactataacgctcattacggtttaggtatgtcttgtatcaagttaggccaa
tatgatgaagcattacttcatttcgaaaaggcacgttctatcaaccctgtgaatgtaatc
ctgaactgttgttgcggggtggcccttgagcgtttgggtcgtcgtgagaaagctctcgac
ttttaccaattagcctgtgaattacaaccaaattcgtccttggcattatttaaaaagtcc
cagctattgttcaatttgggtcagtacagtaatgccttacagaattttgaaaaattagaa
cagttgactccaaacgaagcaccaattcattttctattgggacaattatatcaaatagtc
ggaagaaaaaaagacgccataacacagttcacgattgctatgaatttggatcctaagggt
attcaattggttaaagaggcattggagaaatgtcatgagcagggctaa

DBGET integrated database retrieval system