KEGG   Eremothecium cymbalariae: Ecym_7142Help
Entry
Ecym_7142         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
erc  Eremothecium cymbalariae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:erc04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:erc04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:erc04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(287110..289137)
Genome map
AA seq 675 aa AA seqDB search
MSAVLQETISQLKHLIITHIQQLNYDSAEFFSELLYADCSWINNGSNTGGNTVDDCRDRY
DSLYYYALTLYLQGEYHSSIHVVKDSLRSHLGCAYVYARCCLKLGKHYQEAIQALVVLQD
CWQNGVTNTTDLYMYPDKATILSVLGQLSLKSHQDKESVSFLSQSLSTNSHQLEPLSILF
EMRADLQTVKLFKPVKKSWKSKHLRTSNIISKPQTPFKIPSRLTTSSVAVAPNPLLSTSN
VIVATSPSLMRRSKFLNSSSNTTLTNSSNSNSGSSDSGGNGSNNNNNINNNSNNNNNNNH
NNNNVNNNVQQSTPPSKLLSIDHNKITPEGKTSPSQVQILSHNPVSRRPLDQLLYWMMKA
YKSYYRYDSYRAIRLLNEQLPPHILQSMPWCLSLLSRLHFEIQNHDMALSYFSKLRRLQP
TRLKDMDVYSTLLWHLHDKIRLADLCHELMEQDDKSAITWCCLGNLFSLNRDHDEAIKAL
KKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQ
YDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKS
QLLFNLGQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAMNLDPKG
IQLVKEALEKCHEQG
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgttctgcaggagacaatatcacaactaaagcatttgatcataacccatatt
cagcagttgaactacgattcagcggagttcttctccgaattgttgtatgccgactgctcg
tggatcaacaacggcagcaacacgggtggtaatacagtagatgactgccgggataggtat
gattcgttgtattactatgcattgacgttatatttgcaaggagaatatcattcttctatt
catgttgttaaggattcattgagatctcatctagggtgtgcgtatgtctatgcgagatgt
tgtttaaagcttgggaaacattaccaggaggccattcaagcgttggtggttttgcaggat
tgctggcagaacggtgtgacgaacaccactgatttgtacatgtaccctgataaagcgaca
atattatctgtgttgggccaattatctttaaaatcgcatcaagataaagaatcggttagt
ttcctttcgcagtcgttgtctactaacagccatcagttagagccgctatccatcctattt
gaaatgcgggcagatctccagacagttaaattgttcaaacctgtcaagaagtcgtggaag
tcgaagcatttacgaacatctaatattatttcaaagccgcaaactccgtttaagataccg
tctaggttaacgacatcttcggttgcagttgctccaaatcctttactttctacctccaat
gttatagttgccacttctccgtctctgatgaggcgatctaaatttctaaattcaagtagt
aacaccactttaaccaatagtagcaacagcaatagcggtagcagcgatagcggtggtaac
ggcagtaacaacaacaacaacatcaacaacaacagcaacaataataataataataatcat
aataataataatgttaataataatgtccagcaatctactcctccttcgaaacttctgagt
attgatcataataaaataacgcccgaaggtaaaacttcgccatctcaggttcaaatattg
tcacacaaccctgtttcccggagacctttagatcagttgttatactggatgatgaaagcg
tataaatcatattatcgttatgattcttatagggccattagattattaaatgaacaactt
ccgcctcatattttacaatctatgccttggtgcttatccttattgtctagactacacttt
gagattcagaaccacgatatggcattatcttattttagcaagttgcgtcgcttgcagccc
actagactcaaggacatggatgtttattctactctactatggcatctacatgataaaatt
cgtttagccgatttgtgccatgagttaatggaacaagatgacaaaagtgccattacatgg
tgttgtttaggtaacttgttttctctaaatagagatcatgatgaagccattaaagcatta
aaaaaggctaccaatctcgacccgcggtttgcgtatgcatatactttgcaaggtcatgaa
tactctaataatgatgccttcgataatgctaaaatgtgctaccgcaaagctttggccatt
aaccctaatcactataacgctcattacggtttaggtatgtcttgtatcaagttaggccaa
tatgatgaagcattacttcatttcgaaaaggcacgttctatcaaccctgtgaatgtaatc
ctgaactgttgttgcggggtggcccttgagcgtttgggtcgtcgtgagaaagctctcgac
ttttaccaattagcctgtgaattacaaccaaattcgtccttggcattatttaaaaagtcc
cagctattgttcaatttgggtcagtacagtaatgccttacagaattttgaaaaattagaa
cagttgactccaaacgaagcaccaattcattttctattgggacaattatatcaaatagtc
ggaagaaaaaaagacgccataacacagttcacgattgctatgaatttggatcctaagggt
attcaattggttaaagaggcattggagaaatgtcatgagcagggctaa

DBGET integrated database retrieval system