KEGG   Eremothecium cymbalariae: Ecym_7149Help
Entry
Ecym_7149         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
erc  Eremothecium cymbalariae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ecym_7149
Messenger RNA biogenesis [BR:erc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Ecym_7149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:308042..309139
Genome map
AA seq 365 aa AA seqDB search
MSLYRTTGSTGTTTAMATDKDLVNDITINNPANDSISDIAFSPQQDFLFSVASWDNTVRI
WDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKIASGGCDNVVKIYDVASGQTQQIGSHDAP
VKLLRFVQCGPSNQECIVTGSWDKTIKYWDMRQSQPISTVAMPERVYAMDSRQKLLVIGT
AERHIIIVDLNNPGQIFRTSMSPLKWQTRTIACYIEGNGFAIGSIEGRCAIQYVDEQEQR
KSGFSFKCHRQQQQATATTGTRASTESHVYPVNSIVFHPQYGTFATAGGDGSFHFWDKNQ
RHRLKGFPPMNSSIPVCNFNRNGSVFAYALSYDWHQGHMANRSDYPNVIRLHATTDDEVK
EKKKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcactatatcgaacaactggatctacaggtacaactacagctatggctactgataaa
gatttggtaaatgacataacgatcaacaatccagccaacgactctatctcagacattgca
ttctctccacaacaggattttctttttagtgtggcttcatgggataacacagttcgaatt
tgggatgtacaaaatggtatgacacaaggtcgtgcgcagtatgagcatcaagcacccgtg
ttgacaacgagatggtcttcagatggcacgaagattgcatcgggaggctgtgacaatgtg
gtgaagatatatgacgttgcaagtggacagactcaacaaatcggtagccatgatgctcca
gtaaagttgctgcggtttgtacagtgcgggccctcaaaccaagaatgcattgttactggt
tcgtgggataaaaccatcaaatactgggacatgagacagtctcagcccatttccacggta
gctatgccagaacgtgtctatgccatggatagcagacaaaaactgctggttataggtact
gcggaacgccacataattatcgtagatctaaacaacccaggccagatctttagaacctct
atgtctcctttgaaatggcaaacacgtactatcgcctgctatatcgagggtaacggcttt
gccattggctccatcgaaggcagatgcgcaatccaatacgttgacgaacaggaacaacgt
aaaagcggcttctctttcaaatgtcacagacaacaacaacaagcgacggcaaccacaggc
acccgtgcgtccaccgagtcacatgtataccccgtcaacagcatagttttccacccgcaa
tacggtacctttgctaccgcaggtggcgacggctccttccatttctgggacaaaaatcag
agacatcgtctcaaaggctttcctccgatgaactcctccatccctgtttgcaatttcaac
agaaatggctctgtctttgcatatgccctcagctacgactggcaccaaggccatatggct
aatagatccgattatccaaacgttataagacttcatgccactacagatgacgaagtaaag
gagaaaaagaaacgctga

DBGET integrated database retrieval system