KEGG   Eremothecium cymbalariae: Ecym_7162Help
Entry
Ecym_7162         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ecym_7162
Peptidases [BR:erc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Ecym_7162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:340536..341252
Genome map
AA seq 238 aa AA seqDB search
MYEKIKAVIPLESSPEIFTNFAHELGLKRQMAFDDIYSLTEPDLMAFLPRPMKSIILLFP
VNEFFDATKKKEGENDDEPIDSPDGPVIWFKQIISNACGLYALLHSLANNPDCLTEGSVL
KEFLSLNKREDGKYNDEPTADFMLSISELYHKNSKQGQTEAPLPEATVDLHFITFIAHGG
KIFELDGSRNSAHCLGPARGEDLLDEDLVKGRVQWYMDHADEKMKHQFSLMGMGPSWD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagaaaattaaggcggtgattccgttggaatcaagtccagaaatctttaccaac
tttgcacatgagttgggtttaaaacgtcagatggcatttgatgacatttattcgttgact
gagccagatttaatggcgtttctgccaagacctatgaagtctatcatattattatttcca
gttaacgaattttttgatgcgactaagaagaaagagggtgaaaatgacgatgaacctatt
gactctccagatggtcctgtgatatggtttaaacaaattataagcaatgcttgtggttta
tatgcattgctacattcgctagcaaacaatccagattgcttgacggaagggtcggtacta
aaggaatttttgtcattgaataagagggaagatggtaaatataacgatgaaccaacggcc
gattttatgctatcgattagtgagttgtaccataagaattccaaacagggccagactgag
gctccgttgccagaggctactgttgacctacattttatcacgttcatagcgcatggtggc
aaaatatttgaactcgatggcagtaggaattcggcccactgtttagggcctgctcgtggc
gaagacctcttggatgaggacttggtaaaaggtcgtgttcaatggtacatggatcatgcg
gatgaaaaaatgaagcaccaattctccttaatgggcatgggtccttcctgggattaa

DBGET integrated database retrieval system