KEGG   Eremothecium cymbalariae: Ecym_7240Help
Entry
Ecym_7240         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00040  Pentose and glucuronate interconversions
erc00052  Galactose metabolism
erc00500  Starch and sucrose metabolism
erc00520  Amino sugar and nucleotide sugar metabolism
erc01100  Metabolic pathways
erc01130  Biosynthesis of antibiotics
Module
erc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ecym_7240
   00052 Galactose metabolism
    Ecym_7240
   00500 Starch and sucrose metabolism
    Ecym_7240
   00520 Amino sugar and nucleotide sugar metabolism
    Ecym_7240
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ecym_7240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP DUF4301
Motif
Other DBs
NCBI-GeneID: 11472522
NCBI-ProteinID: XP_003647902
UniProt: G8JW70
Position
7:505508..507007
Genome map
AA seq 499 aa AA seqDB search
MLQVRKHNKTHSTYAFESNTNNVAVSQMRNALNKLADSVKDEKTQSRFETELDSFFSLFR
RYLVEKSSHSTLDWEKIKSPSSDEVIKYAEIAQQPENVSNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDSDTEHLIKKYSANRIR
IRSFNQSRYPRVFKDSLLPVPQDYQDQLDAWYPPGHGDLFEALHMSGELDVLLEQGREIL
FVSNGDNLGATVDLKILNHMLETGAEYIMELTDKTRADVKGGTLINYEGQVRLLEVAQVP
KEHIDEFKNIRKFTNFNTNNLWINLRAIKRLVEASTLTMEIIPNKKTITRNGNEIDVLQL
ETACGAAIRHFNGAHGVVVPRARFLPVKTCSDLLLVKSDLFFLEHGALKLDPSRFGPNPL
IKLGSHFKKVSGFNSHISHIPKIVELDHLTITGNVFLGKNVTLKGTVIIVCSDGQRIDIP
NGSVLENVVITGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttacaagttaggaaacacaacaaaacacactcaacttatgcttttgagtcgaataca
aacaacgtggcggtctcgcagatgaggaatgcgttaaacaagttggcagattctgtaaag
gatgagaaaactcagtctcggtttgagactgagttggattcatttttctctttgtttagg
agatatttggttgagaaatcgtcgcattctactttagattgggagaagatcaagtctcct
agttcagatgaggttatcaagtatgctgagattgcgcaacagccggaaaatgtgagtaat
ttgtccaagttggctgttttgaagttgaatggtgggttggggacttctatggggtgtgtt
gggcccaaatcggttattgaggttagggatgggaacacatttttggatctttcggttcgt
cagattgagtatttgaacaggcagtatgattcggatgttccgttgttgttgatgaattcg
tttaatacggattcggatactgaacacttgatcaagaaatattctgctaatagaattaga
ataaggtccttcaatcaatctagataccctcgtgtgtttaaggattctttgttacctgtt
ccgcaagattaccaagaccaactggatgcttggtacccccctggccatggtgatttgttt
gaggcattacatatgtcaggtgaattggatgttctcttggagcaaggaagagagattcta
ttcgtgtctaatggtgacaacctaggagccactgtggatttgaagattttgaaccacatg
ctggagactggtgctgaatatataatggagttaactgacaagactagagccgatgtcaag
ggtggtaccttgataaattatgaaggccaagtgcggctattggaggttgctcaagttcca
aaagagcatattgatgaattcaagaacattaggaaatttaccaatttcaataccaataac
ttgtggatcaatttaagggctatcaagaggttggttgaggcatccactttgactatggaa
atcattcccaacaagaagacgatcacgagaaacggcaacgaaattgatgttctacaattg
gaaactgcatgtggtgcagcaattaggcactttaatggtgcacatggtgttgttgttcca
agagctcgtttcttacccgtcaaaacttgttctgacttgttgttggttaagtcagatttg
ttcttcttggaacatggtgccttaaagctagatccttctagattcggtccaaacccgttg
atcaaactaggctctcacttcaagaaagtttctggatttaattcccatatctcccacatc
ccaaagattgtagaattggatcatttgaccatcaccggtaacgttttcttgggtaaaaac
gtcaccttgaagggtaccgtcattattgtatgctcagacggccaaagaatcgatattcca
aatggttccgttttggagaacgttgtcatcactggcaacttacaaatcttagaacattga

DBGET integrated database retrieval system