KEGG   Eremothecium cymbalariae: Ecym_7327Help
Entry
Ecym_7327         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ecym_7327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:693540..694724
Genome map
AA seq 394 aa AA seqDB search
MAVDLKPENWTVSSTEALKLSLVDDNGAIQFRPTFTYPIFGDSEQIFGYQNLSICLAFDS
VTFKPFINAKYDKMMDDIDDVQEKLLNFLPEEDVVIKDEVRWVDKFQKERESFTLPDDEL
KIAEYSSDGEQYAVYQTKLSDDPIRKLHKRMQIFTLLFIESASYIDEEDNSWDIFISFKK
STKQCIGYATAYKYWRYINGTQFDASEILAKRAKISQFIIFPPYQSRNHGSHLYNAVVNL
WLKTPEITEITIEDPNESFDDLRDRNDLQRLYTAGFFKTIPDELPISKKWLEEKMSEYKL
ERRQFVRLVEMILLHKKSSNFRLQVKNRLYEKNYEVLANMDDSTIKDKLQTAFQLVKDDY
ERILQTVKFEKREIVDDFNTNIVKKQKLKTETKL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgatttaaagccggaaaattggactgtatctagtactgaggctttgaagtta
tctttggttgatgataatggtgcaattcagttcagacctacttttacttacccaattttt
ggtgactctgaacagattttcggatatcagaatctgagcatctgtttggcgtttgattct
gttacttttaaaccttttattaatgccaaatatgataaaatgatggatgatattgatgat
gttcaggaaaagctattgaatttcttacctgaagaagatgtagttattaaggacgaggtt
agatgggttgataaatttcaaaaagagagagaaagctttacgttacctgatgatgaattg
aagattgcagaatattcatcagacggagaacaatatgccgtatatcaaaccaagctatct
gatgatcccattagaaaacttcacaagcgtatgcagatctttaccttgttgttcatcgaa
tctgcgtcatatattgatgaagaagataattcttgggatatctttatttcttttaagaag
tcgacgaagcaatgtattggttacgctacagcatataaatactggagatatatcaatgga
acccaattcgatgcttctgagatactagcgaaaagagctaaaatttctcaattcattata
tttcctccataccaatctaggaaccacggttcccacttatacaatgcagttgttaatttg
tggttaaaaaccccagaaataacggaaataacaattgaggatccaaacgaatctttcgat
gacttaagagacagaaatgaccttcaaaggttatacacagcaggatttttcaaaactatt
cctgatgaactgccaatatcaaaaaaatggctagaagaaaagatgagtgagtataagttg
gagagaaggcaatttgtccgtctagttgagatgatcttattgcataaaaaatcatcaaat
ttcagactacaagttaagaatagactatacgaaaagaactatgaagttttggccaatatg
gatgatagcactataaaagataagctccagactgcattccaattagtaaaggatgattac
gaacgtatacttcaaacagttaaattcgagaaacgtgaaatagttgatgattttaacacg
aatatcgtaaagaaacaaaaattaaaaacggagacaaaattatga

DBGET integrated database retrieval system