KEGG   Eremothecium cymbalariae: Ecym_7339Help
Entry
Ecym_7339         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
erc  Eremothecium cymbalariae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ecym_7339
Enzymes [BR:erc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ecym_7339
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ecym_7339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:710796..711818
Genome map
AA seq 340 aa AA seqDB search
MGHTAEFLAANETEISSVLSGGYNHPLLREWQNERSLNKNMFIFPLFVSDDPDEEKPIES
LPNIKRFGINKLAAYLKTLVTKGLRSVLLFGVPLKPGCKDEVGTAADDPEGPVIQAIKLL
RRDFPELYILCDVCLCEYTSHGHCGVLFDDGTINRELSVRRIAAVAVNYAKAGAHCVAPS
DMIDGRIKEIKLGLIQARLAHKTFVMSYAAKFSGNLYGPFRDAACSMPSYGDRKCYQLPL
GGRGLARRALRRDLGEGADGIIVKPSTFYLDIMADASEIAKDVPICAYHVSGEYAMLHAG
AKAGVVDLKSIAFESHQGFLRAGARLIISYMTPEFLDWLS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatactgcagagttcttggctgctaatgagacagaaatctcatctgttctttca
ggcggttacaatcatccactattaagagaatggcagaatgaaagatcattaaataagaat
atgtttatcttcccattatttgttagtgatgatccggatgaagagaagcccattgagtcc
ttgccaaatattaaacgttttggtatcaataaattggcagcttatctgaaaaccttagtt
accaaaggccttcgttctgtgcttttgtttggagttcctttgaagcctggttgtaaagat
gaagttggaaccgctgctgatgatccagagggacctgtaattcaggcaattaagctgctt
cgccgggattttcctgaattatatattctgtgtgatgtttgtttatgtgagtacacttct
catggccattgtggtgttctattcgacgatggcaccatcaatagggaattgtcagtccgt
cggattgctgcagtagctgtcaattatgccaaggcaggggcgcattgtgtagctccaagt
gatatgattgatggcagaatcaaagaaattaagttgggtttaatacaggctcgtctagcg
cacaagacatttgttatgagctacgctgcgaaatttagcggcaacctgtatggtccattc
cgtgatgcagcatgttccatgccatcatatggtgaccgtaagtgttaccagttaccattg
ggaggtcgtggcttggctagacgtgctttaagacgagatttgggagaaggtgcagatgga
ataattgttaagccttccacgttttatttggatattatggcagatgcttcagaaattgcg
aaagatgttccaatatgcgcttaccatgtttctggtgagtatgcaatgttacacgcaggc
gctaaagctggtgtagtggatctcaaatccattgcctttgagtctcatcaaggctttttg
agagctggtgccaggttaatcattagttatatgactcctgaattcttagactggttaagt
tga

DBGET integrated database retrieval system