KEGG   Eremothecium cymbalariae: Ecym_7356Help
Entry
Ecym_7356         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
erc  Eremothecium cymbalariae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Ecym_7356
Enzymes [BR:erc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Ecym_7356
Glycosyltransferases [BR:erc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Ecym_7356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:740507..742762
Genome map
AA seq 751 aa AA seqDB search
MSTSGYSRGDVGTLGRRGASDANADDVVSEKEEGLKLDTKIVNGEAEEEEEVNPLYRWEA
IVMPILFTALAIFTRVYKIGLNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFS
GYLAGYNGSWDFPSGEQYPEYIDYVKMRLFNSMFSSLCAPLAYFTAKAIGFSLPTVWLFS
ILVVFENSYATLGRFILLDSMLLFFTVCSYYTFVMFHNERSRPFGRKWWKWLLLLGISLG
CTISVKMVGLFIITLVGIYTIVDLWNKAGDPEIDVKDFLKHFGARAFCLIIVPILLFLFC
FKIHFDLLVRSGTGDAVMPSLFQARLVGSDVGLGPRDIAVGSSVVSIKNQALGGSLLHSH
VQTFPEGSNQQQITCYGHKDSNNNWKFDRMRGLDPWNESVDTDPEFVQDNHVYRLVHINT
LRNLHSHQIRAPITNSYWEVSGYGNNEIGDPKDNWVIEFVDQPTEENKTVLHTLSTSFRI
RHSEMNCYLAQTGAHLPEWGFRQAEVACVPNPFKRDKRTWWNVETHENDKLPARPEGFRF
PKTKFIKDFIHLNLAMMATNNALVPDPDKLDVLASSAWQWPSLNVGIRLCGWSDELVRYF
LMGSPASTWPSTFAVIILISMVIYYLLRWQRQCVIFQSHQDANLFLVGALYPLLGWALHF
LPFVIMGRVTYVHHYLPALYFALLGLSYLFEAGMQSWKKSSYGRLARIGVYGLYYFIVIY
GFYYFFPISAGMSGPVKDFEYLNLLKTWTIA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttcgggatatagcagaggtgatgttggaacgttaggaaggagaggagcttcg
gacgctaatgctgatgatgtagtttctgagaaggaggaaggtttaaagttggacactaag
atagttaatggggaggcggaggaggaagaagaggttaatcctttgtataggtgggaggct
attgtgatgccgatattgtttacagcgctagcgatatttacaagagtttacaagatagga
ctgaataatcatgttgtttgggatgaggcacattttggtaagtttggttcgtattattta
agacatgagttttatcatgatgtccatccgccattggggaaaatgttggtggggttctca
gggtatcttgcggggtataatgggtcgtgggactttccttctggggagcagtatccggag
tatattgattatgtgaaaatgaggcttttcaactcaatgttttcgtcgctatgtgcgcca
ttagcgtattttacggcgaaggctattggattttctttacccacggtgtggttgtttagt
attttggtggtgtttgagaattcgtatgctactttggggaggtttattcttttggattca
atgctactctttttcacggtgtgttcctactatacttttgtgatgtttcataatgagaga
agcaggccatttggccggaaatggtggaagtggctcctattgctaggtatttctctagga
tgcacgatttccgttaagatggtgggtttgttcattatcactcttgttggtatttatact
attgtggacctatggaataaggcgggggaccctgagatcgatgttaaagactttttaaag
cactttggcgccagagcattctgcttgattattgttcctatcctattgttcctcttttgc
tttaagattcactttgacctattggtacgctcaggtactggtgatgcggtcatgccctcg
ctgttccaagcacgtttggtcggatcagacgtcggattaggcccacgtgatattgcagtc
ggttcatctgtcgtttctatcaaaaaccaggcgttaggaggctctctattgcactcacat
gtgcaaactttcccggagggctctaaccaacagcagattacttgttatggacacaaagat
tcaaacaataattggaaatttgatagaatgaggggcttagatccatggaatgaatctgtt
gacacagaccccgaatttgttcaagataaccatgtttacaggttggttcatatcaacact
cttagaaacttacactcacaccaaattcgtgcaccaatcactaactcatattgggaagtt
tctggttatggcaataacgaaataggtgatcctaaggacaactgggtaattgaatttgtg
gaccaacccacagaagaaaataagacggttttgcatactctatcaacttctttccgaatc
agacacagcgaaatgaactgctacctagctcaaactggtgctcatctacctgagtggggg
ttcagacaggccgaggtagcatgtgtgcctaatccatttaaaagggataagaggacttgg
tggaatgttgaaactcatgaaaatgacaagttacctgcaaggccggaaggtttcagattc
ccaaaaaccaagtttattaaggattttattcacttaaacctagcaatgatggcaacaaac
aacgcattagttcctgaccccgataagttagacgtattggcatcttctgcttggcaatgg
ccatctttaaatgttggaatcagattatgtggatggtccgatgagctggtcagatatttc
ttgatgggttcaccagcctccacatggccatcaactttcgcagtaattatattaattagc
atggtcatttattacttgttaagatggcaaagacaatgcgttattttccagagccatcag
gatgctaacttattcttagtgggcgcgttatacccattgttgggctgggccttacatttc
cttccattcgtaattatgggtagggtgacatatgtacatcactatttgccagccttatac
tttgcgttattgggtttatcatatttgtttgaagcaggcatgcaatcatggaagaaatct
tcttatggccgtctggcgagaattggtgtctatggattgtattatttcattgtaatttat
ggattttactatttcttcccaatttctgcaggtatgtctggtccagtgaaggattttgaa
tacttgaacttgttgaagacttggaccatcgcttaa

DBGET integrated database retrieval system