KEGG   Eremothecium cymbalariae: Ecym_7361Help
Entry
Ecym_7361         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
Organism
erc  Eremothecium cymbalariae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(753862..755313)
Genome map
AA seq 483 aa AA seqDB search
MKMSNTIERHTFKVFNQDFTVDKRFQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTN
VFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVLQADGTFNGLYLYEELMECDMHQI
IKSGQPLTDAHHQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGY
SENPVENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGKPIFKGKDY
VDQLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGFIPKVPFHKLYPNANPQAADLLERM
LAFDPKTRITVDEALEHPYLSIWHDPSDEPVCNKKFDFGFESVNEMEQLKQMVIEEVNDF
RMFVRQPILDSSPADQQPSASQQGIQQIPMENSISDNSKSFDDQDFAQQMISSQSPTLIH
DSFIGIHSENLPEHNTDFPPRPQENMLASPMGFSGGNGNHSGTEFGDFLDLERELEFGLD
RKI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgtctaacactatagaacgtcatacgtttaaggtgtttaatcaggactttacg
gtagacaagaggttccagttaataaaagaaattgggtatggtgcgtatggtattgtatgc
tctgcgaggtttatggaatccgttgaggatacgacggttgcaataaagaaggttactaat
gttttttcgaagacgttgttatgcaagaggtcattgcgggagttgaagttgttaagacat
ttccgtgggcataagaacattacatgcctgtatgatatggatattgttttgcaagcagat
gggacgtttaatgggttatatctctatgaggagcttatggagtgtgacatgcatcagatt
attaagtctgggcaaccgttgactgatgcgcaccatcagagttttgtatatcaaattctt
tgtgggctgaaatatattcattctgcagatgttttacacagggacttgaaacctgggaat
ttgcttgtgaatgcagattgtcagttgaagatttgcgattttggtctggcgcgaggttat
agtgagaatcctgtagagaataaccagtttttaacggaatatgttgcaacaagatggtac
cgtgcacctgagattatgttaagttatcagggctatacaagagctatagatgtttggtca
tgtggatgtgtcctagcagaacttttagggggcaaaccgatctttaagggtaaggactat
gtagatcaactgaacagaattttacaagttttaggcactccgccggaggaaactttgaaa
cgaattggttctaagaatgtgcaagattatattcaccagttgggatttattccgaaggtg
ccatttcacaagttgtaccctaatgctaacccacaggcggcagatttgttggaacgtatg
ctcgcttttgacccaaagacgaggattaccgtcgacgaggcattagaacacccctatttg
tctatctggcacgaccctagtgatgagccagtatgtaacaaaaagtttgatttcggcttt
gaaagtgtaaacgaaatggagcaattgaaacaaatggttatagaagaggtcaacgacttt
aggatgttcgttagacagcctatattggatagttctcctgctgatcagcaaccaagcgct
tctcaacaaggtattcaacaaataccgatggaaaattcaatttccgataatagtaaatcg
tttgacgaccaagattttgctcaacagatgatttcttcacaatcacccacattaattcac
gactcattcattggaattcattcagaaaacctgcccgagcataacacagacttcccacca
aggcctcaagagaacatgttggcatcgcctatgggtttttcaggtggtaatggtaatcat
agcggcactgaattcggcgactttttggatctggaaagggaattagaattcggtttggat
agaaaaatttga

DBGET integrated database retrieval system