KEGG   Eremothecium cymbalariae: Ecym_7391Help
Entry
Ecym_7391         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:erc01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:erc00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:erc00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:erc00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:801773..802900
Genome map
AA seq 375 aa AA seqDB search
MLKVTGACVGRSFASSSKLFVRLSSTSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNE
ILVNVKYSGVCHTDIHAWKGDWPLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKW
LNKSCMSCEYCETGHESNCAEADLSGYTRDGSFQQYATADAVQAAKIPQGTDLAQVAPIL
CAGVTVYKALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGLRVVGIDGGAAKDALFKK
LGGEVFIDFTKSKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYIRPTGTVVLVGLPA
NSYVNSEIFSHVIKSISIKGSYVGNRADMREAIDFFTRGLVKAPIKIIGLSELPTAYHEL
EAGNMVGRFVVDTSK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggttacaggtgcttgtgttggaaggtcgtttgcttcttcgtctaagctattc
gtgaggctgagttctacgtcatctgggattcccttgacgcagaaggctgtcatattctat
gagcacggtgataaattacactacaaggatataccggttccaaagccaaaacccaatgaa
atcttggttaatgtcaagtattctggggtttgtcataccgatatacatgcgtggaagggg
gattggccattagctacgaagttgcccttggttggtggacatgaaggcgctggtattgta
gtggccaaaggctcgaatgttacgaattttgaaatcggtgattatgcaggtgttaagtgg
ttgaataagtcatgtatgtcatgtgagtactgtgaaactgggcatgagtctaattgtgcg
gaagcagacttgtcaggttacacacgcgatgggtcgttccaacagtatgccactgcggac
gctgttcaagcggcgaagattcctcaaggtaccgatttggcgcaagtcgcaccgatactg
tgtgctggtgttacagtttataaggctttgaaaaccgctaatttggatccaggtcaatgg
gttgcgatttctggcgctggtggtggtctaggttcactcgcagttcagtatgcaaaagct
atgggattgagggttgttggtattgatggtggagcagcgaaggatgctttgttcaagaag
ttaggcggtgaggtgtttattgattttactaagtctaaggatattgtggcggacattcag
gaagctacgaatggtggtccacacggggctgttaatgtctctgtgtctgaagcggcgatt
gtgcaatcggttaaatacatcaggccaactggtactgtcgttttggttggtttgcccgcc
aattcatatgtaaattcagaaatcttctcgcatgttatcaagtcgattagtattaagggt
tcttacgtaggcaacagagctgacatgagagaagctatcgacttcttcaccagagggttg
gttaaagccccaattaagattatcggtctttcggaacttccaacggcttaccatgagttg
gaagctggtaatatggtaggtaggtttgttgttgacacatccaaatga

DBGET integrated database retrieval system