KEGG   Eremothecium cymbalariae: Ecym_7391Help
Entry
Ecym_7391         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ecym_7391
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecym_7391
  Lipid metabolism
   00071 Fatty acid degradation
    Ecym_7391
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ecym_7391
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ecym_7391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:801773..802900
Genome map
AA seq 375 aa AA seqDB search
MLKVTGACVGRSFASSSKLFVRLSSTSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNE
ILVNVKYSGVCHTDIHAWKGDWPLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKW
LNKSCMSCEYCETGHESNCAEADLSGYTRDGSFQQYATADAVQAAKIPQGTDLAQVAPIL
CAGVTVYKALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGLRVVGIDGGAAKDALFKK
LGGEVFIDFTKSKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYIRPTGTVVLVGLPA
NSYVNSEIFSHVIKSISIKGSYVGNRADMREAIDFFTRGLVKAPIKIIGLSELPTAYHEL
EAGNMVGRFVVDTSK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggttacaggtgcttgtgttggaaggtcgtttgcttcttcgtctaagctattc
gtgaggctgagttctacgtcatctgggattcccttgacgcagaaggctgtcatattctat
gagcacggtgataaattacactacaaggatataccggttccaaagccaaaacccaatgaa
atcttggttaatgtcaagtattctggggtttgtcataccgatatacatgcgtggaagggg
gattggccattagctacgaagttgcccttggttggtggacatgaaggcgctggtattgta
gtggccaaaggctcgaatgttacgaattttgaaatcggtgattatgcaggtgttaagtgg
ttgaataagtcatgtatgtcatgtgagtactgtgaaactgggcatgagtctaattgtgcg
gaagcagacttgtcaggttacacacgcgatgggtcgttccaacagtatgccactgcggac
gctgttcaagcggcgaagattcctcaaggtaccgatttggcgcaagtcgcaccgatactg
tgtgctggtgttacagtttataaggctttgaaaaccgctaatttggatccaggtcaatgg
gttgcgatttctggcgctggtggtggtctaggttcactcgcagttcagtatgcaaaagct
atgggattgagggttgttggtattgatggtggagcagcgaaggatgctttgttcaagaag
ttaggcggtgaggtgtttattgattttactaagtctaaggatattgtggcggacattcag
gaagctacgaatggtggtccacacggggctgttaatgtctctgtgtctgaagcggcgatt
gtgcaatcggttaaatacatcaggccaactggtactgtcgttttggttggtttgcccgcc
aattcatatgtaaattcagaaatcttctcgcatgttatcaagtcgattagtattaagggt
tcttacgtaggcaacagagctgacatgagagaagctatcgacttcttcaccagagggttg
gttaaagccccaattaagattatcggtctttcggaacttccaacggcttaccatgagttg
gaagctggtaatatggtaggtaggtttgttgttgacacatccaaatga

DBGET integrated database retrieval system