KEGG   Eremothecium cymbalariae: Ecym_8095Help
Entry
Ecym_8095         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
erc  Eremothecium cymbalariae
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:erc00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    Ecym_8095
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Ecym_8095
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Ecym_8095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:205952..207106
Genome map
AA seq 384 aa AA seqDB search
MSHFLPAHVPTEEIPQQQDRTSPVSVISSKDDRSLYKKYPIGRDWIQGSVNNNGGVHAGL
EGSITKGKYTLYDFQILRTLGTGSFGRVHLVRSAHNGRFYAMKVLKKHVVVKLKQVEHTN
DERRMLSVVSHPFVIRMWGTFQDAQQVFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE
VCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYTLCGTPDYIAPEV
VSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAELKFPPFFHIDVQNLL
SKLITRNLSKRLGNLENGSRDVKAHPWFSEVIWDKLLCRNIETPYEPPIRPGQGDTSQYD
RYPEEEVNYGILGDDQYHSLFCDF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatttcctaccagcccatgtaccgactgaagaaatcccgcaacaacaagaccgt
acaagtccagtttcagtcatatcgtctaaggatgatcgttcactttataaaaaatatcct
ataggaagagactggatacaaggatctgtcaataacaacggcggggtacacgcagggtta
gaaggaagcattaccaaaggaaaatacacgttatacgatttccaaattcttaggactcta
ggaacaggtagttttggaagagttcacctagtacgttctgcccacaatggtagattttat
gctatgaaggttttaaaaaagcatgtcgttgttaaattaaaacaggttgaacacactaat
gatgaaagaagaatgctttctgttgtttcacatccgtttgtgattagaatgtggggaacg
ttccaagacgctcaacaggtatttatagttatggactacattgaaggtggtgaactgttt
tctttgttgcggaaatcgcagaggtttccaaatccggttgcaaagttctatgctgcagaa
gtatgcctagcactggaatacttgcactccaaagatatcatatatcgtgacctcaagcct
gaaaacatcttactggataagaatggtcatataaagctgacagactttgggttcgcaaag
tatgtcccagatgtaacatataccctgtgcggcactcctgattacatcgcacctgaagta
gtaagcacaaaaccttacaacaaatcagttgattggtggtctttcggtatattaatctac
gaaatgcttgcaggctacaccccattctatgaccagaacacaatgggaacctatgagaat
attctaaacgcagaacttaaatttcctccattcttccacatagatgtccaaaacttactc
tccaaactcatcacaagaaatctcagcaagagactgggcaatcttgaaaatggctcccgt
gatgtcaaagcccatccctggttcagtgaagtaatatgggataagctactttgtagaaac
attgagacaccctacgaacctcccatccgccctggccaaggagatacatcccagtatgat
aggtatccagaagaagaagtcaactacggcatccttggagatgaccaataccactctctc
ttctgcgacttttaa

DBGET integrated database retrieval system