KEGG   Eremothecium cymbalariae: Ecym_8108Help
Entry
Ecym_8108         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
erc  Eremothecium cymbalariae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Ecym_8108
Enzymes [BR:erc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Ecym_8108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:230588..232636
Genome map
AA seq 682 aa AA seqDB search
MSTSSSPSNSLPLQGTVGLFLDKEDKTEQAKKTFIELEKSTYAHKRLGNSPSHEFMECDC
FEEYRDGKNHACGETSDCINRLTLIECVNELCTSCGDNCQNQRFQGRQYADIAVFQTEKK
GYGVRAEKDIEANEFIYEYIGEVISESEFRERMVDYDVRGYKHFYFMMLQTGEFIDATEK
GCLARFCNHSCNPNAYVSKWDVAGKLKMGIFANRKIFKGEEITFDYNVDRYGATAQPCYC
DEPNCIGFLGGKTQTDAASLLPQNYADALGVKPSIEKKWVKMKKAKGEEIDKGDSNNINV
EFVNSLELEPCIKYSDVNKVMSVLLQIDNEFVCSKLLQRLLLTEDETMCYQIIKLHGYKC
FDKLLTMFDDEETQYTILNYLSKLPRTTKNGIISSQIDKKINSLKSNPRLEKIATQLSER
WDTFEIYQRIAKRDPADSSANGISNVTDFRRIRIPAGQENHEGGNSVNFTQRQLTRGDQS
NDFHKSNSPNSINSSRSNGTFFDRTKKRPLDPDLYEKRKRRRMEWEKQELEKKKQEEVRY
LKKKLEIEKQKKSELQQIIEEANKQKEQELQERLQKEKEEIERRERRKQTHSVSRSEHKW
NKFFASLVPNLIKSYESGLDRGRIKDCARDIVKILSNKELKKDPNKVPPSEVTKEKKKKV
KEFCKIYMDKLVLKIHQKPPSK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcttcatcgccatcgaatagcctaccgcttcaaggcacagttgggttattt
ttagacaaggaagataaaactgagcaagctaagaagacttttatagaattggaaaaatct
acatatgctcataagcgtctaggaaactcacctagtcatgaatttatggagtgtgattgt
tttgaagaatatagagatggaaaaaaccatgcatgtggtgaaacttcagactgtataaat
aggcttacactgattgaatgtgttaatgaactctgtacatcatgtggtgataattgccaa
aaccaaaggtttcaaggaaggcagtatgcagatattgccgtattccaaacagaaaaaaaa
ggttatggggtaagagctgagaaagatattgaagctaatgaatttatttatgagtatatt
ggagaggtgatatctgaatctgagtttcgtgaaagaatggtggactatgatgtaagagga
tacaagcacttttatttcatgatgttacaaactggagaatttattgatgctactgaaaaa
ggttgtttggctaggttctgtaatcattcatgtaatcctaatgcatatgttagtaaatgg
gatgttgcaggcaaactaaagatgggtatatttgctaataggaagatttttaaaggtgag
gagattacttttgattataatgttgatagatatggtgcaacagcacaaccatgctattgt
gatgagccaaattgtattgggtttcttggtggcaaaacccaaactgatgcggcttcttta
ttaccccagaattatgcagacgcactaggagttaaaccatcaatagagaagaagtgggta
aaaatgaaaaaagcgaaaggtgaggagatcgataaaggtgattctaataatattaatgtc
gaattcgtgaattctctcgaattagaaccatgtattaaatacagtgatgttaacaaagtt
atgagtgtgttgctgcagatagataatgaatttgtatgttccaaactacttcagcgtttg
cttcttacagaagacgaaactatgtgttaccagattattaaattacatggttataaatgt
tttgataagttgttgacaatgtttgatgatgaggaaacccaatacacgattcttaattat
ctcagtaagctgccaaggaccactaaaaacggtataatatcctcgcagattgacaaaaag
ataaattcattgaagtcaaacccccggctagaaaaaattgctactcaactttctgaacga
tgggatacgtttgaaatataccaacggattgctaagagagatcctgcagattcgagcgcc
aatggaattagtaatgtaaccgactttagaagaatcagaataccagcgggacaggaaaac
catgaaggtggaaattccgtgaatttcacacaaagacaacttacgagaggcgatcagtct
aatgactttcataaatcaaattctccaaattctattaattcatcaagatctaacggaact
ttttttgatcgcaccaagaaaagacctttggacccagatttgtacgagaaacgtaaaaga
agaaggatggagtgggaaaaacaggaactggagaagaagaaacaagaagaagtccgttat
ttaaagaaaaaactggaaatagaaaagcagaaaaagtcagaattacaacaaatcatagaa
gaggcgaataagcaaaaagaacaagaactacaagagcgtctgcagaaagaaaaggaagag
atagagaggagagaaaggcgtaaacagacgcattctgtcagtcgtagtgaacataaatgg
aataagttttttgcatccttagtacccaacttaataaagtcatacgaaagtgggttagat
agaggacgtattaaggattgtgcaagagatattgtcaaaatattatctaacaaagaatta
aagaaagatccaaacaaagtgcctccatctgaggttaccaaagaaaagaaaaagaaagtg
aaagaattttgtaaaatctacatggataaactggttttgaaaatccaccaaaagcccccg
tcaaagtaa

DBGET integrated database retrieval system