KEGG   Eremothecium cymbalariae: Ecym_8139Help
Entry
Ecym_8139         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
erc  Eremothecium cymbalariae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ecym_8139
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ecym_8139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:294684..295688
Genome map
AA seq 334 aa AA seqDB search
MGITVIGSLNYDLVTFTDHIPNMGETISGKCFETHVGGKGLNQAIALSNLKPDSIAEAVR
MVGNIGEDSFGSELLRVGRTSGLNMEYVGRHDDVRTGTATILVEESSGQNRIICVSGANM
KTVFDKERLQLVFPAKGGSSEEYVILQHEIPDPCSIMHWLRENRPEHLIVFNPSPFQHLD
PLDWKAVDILVVNEVEALQLLSSLYDNNDVARYQSLVETNLIEGYTMIAQEFKSRKVLNS
NGPGVIIITLGENGIIYTSRTQSDISYFPATHIDNVIDTTAAGDTFLGGVVMQLYNGSTL
HDAVKFAAYASAIAITRKGASNSIPSYAEVMEKL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggtattacagttattggttcgcttaactatgatttagtgaccttcacagatcacatt
cccaacatgggtgagacaatatctggaaagtgcttcgaaacgcacgtaggaggtaaaggg
ttgaatcaagcaattgcattgagtaatttaaaaccggactctattgcggaggcagtaagg
atggtggggaatattggggaagactcttttggttccgaactgttaagggttggtagaaca
agcggtcttaatatggaatatgtcgggaggcatgatgatgttagaactggtactgctacc
atcttggttgaagaatcgagtgggcagaatagaattatttgtgtaagtggggcaaacatg
aaaaccgtatttgataaggagagacttcaattagtcttccccgcaaaaggtgggagtagt
gaagaatatgttatattacaacatgaaatccccgacccatgctcaattatgcattggctt
cgagaaaacagacctgaacatctgatagtgtttaacccatctccatttcaacatttggat
ccccttgactggaaggcggttgacattttagttgttaacgaggttgaggcgttacagtta
ctttcatctctgtacgataacaatgatgtagcacgttaccagtcattggttgagactaat
ctaattgaaggctataccatgatagcgcaagaatttaagagtaggaaagtccttaatagc
aatgggcctggagtaattattataacattaggcgaaaacgggattatctatacgtcaagg
acacagtcagacatatcctattttcctgctactcatatagataatgtcatagatacaaca
gccgctggagatacattcttaggcggtgtcgtgatgcagctatataatgggtcaactttg
cacgatgctgtgaagtttgctgcctatgcaagtgcgatagctattactagaaagggcgca
tcgaacagtataccaagctatgcagaagtcatggaaaaattatga

DBGET integrated database retrieval system