KEGG   Eremothecium cymbalariae: Ecym_8140Help
Entry
Ecym_8140         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ecym_8140
Peptidases [BR:erc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ecym_8140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(295730..299524)
Genome map
AA seq 1264 aa AA seqDB search
MNKLKSQDNVVHGGPLLEELEGTQTKEDVASLDNWQAEVDTIQTNLNSSEDCAVGTLVSE
NSLNEQPTRLVAFSDDSDSMLVDAIPSLEEQRVIVNKLWEEFVKASTEGDKMYIVPSQWS
TKFLDQNQTDYTALGQMDIKSVVLDRANLILAPFDLNPYIAVPEPVFNRWYEWYGVTEGS
FPFYTVLVKDAGGQLIVEYDRPKFMVHYLTINEDTQNYKCNAQVPIFFTMSRLSTMEDVV
TRAMKLFCERESSVDIDVTNFRTWYIKDKPSASENVNDYLTTNYKIKPSTFVEFPMKHLI
KSEQLSYSIKDYDSETIDLAVELKPPAKNQHWASNYYIYNQMTPSNGTVGLGNLGNTCYM
NSALQCLVHIPEFKDYFLYNAYEKEINVDNPLGHKGHIAWAFGTLIQSLFGKRNNLISSY
SPRHFKTTIGHLNSMFAGYQQQDSQEFLAFLLDGLHEDLNRIVDKPYVEKPELNPTDDVT
EFETIKKLADDTWLKHKLRNDSVILDLFVGLYKSTLICPTCKKVSTTFDPYNDLTLPLPV
DSTWSNKVLIFPHSSPPYTFEVELNKTDTYCDLKKYVARCTGMNTADLLGAEVFNHQFYN
NYEASRADSQYLPIHELISDSDVVVFYEVPRSENDLVVPVMNTVIEDGFRSAKLCGFPFF
ISLSEEEQSDYGVILQKLENAFIQWSGGFTEFTLASKKNDTITLDQLPVLQKKYPGLQPE
AVATELKYINPEQPPEKFFKIKIYDGQINNQRSRFASQPYPRSARNDLWTPEPHVTFSKV
KDITANLDQVLWDAYNYASIGLEGSVENPNIEYSGCNNFCESEDASILNVTSQNIGPHTQ
SSDSDMDIEVSIDNQDLQKAESSEEHSLDLVADTLNDIPREKLIKAQNAIICEWNSKSYD
EVFNSSLKVNWDSPGEVPNTELEASKRERNAQEEKKITLHDCLTLFSTPEVLGATDSWYC
PSCKEHRQATKQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKD
DKKGTIYDLIAVDNHYGGLGGGHYTAYVKNFLDNKWYYFDDSRVNETVPERSIAGSAYLL
FYRRRTESNYVGSQYLCDIINKSRQKYDERMKQFNDAVLDLYTESRSDNEDESEHNQEQS
LEDEETEDEDKRETVHLLTLADGRVDQRGSIPIKGMISPNSDYSIASLEVGDGSRVSGND
EDNHNNSRRKLRLLQKTYNSQSSDIASPESTPCSSTGSISDENTENTKIGPTRNESIPDS
PSVS
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttgaagagccaggataacgttgtgcacgggggaccattactggaggagtta
gaggggacgcagactaaagaagacgtggcatcattggacaattggcaggcggaagttgat
actatacagaccaacttgaattcatctgaagattgtgccgttggcaccctagtctctgaa
aatagccttaatgaacagcccacaagactggttgctttttcagatgatagtgattcaatg
ttggttgacgcgatcccatctttggaggagcagcgagttattgttaataagctttgggag
gagtttgtaaaggcatctacggagggtgacaagatgtacatcgtgcctagtcagtggtcg
actaaatttttggatcaaaatcagacagattatactgctttagggcaaatggatattaag
tctgttgttttagatagagctaatctgattcttgcgcccttcgatctgaatccatatatt
gcagttcctgaacccgtatttaaccggtggtatgaatggtatggagtgacggagggttct
ttcccattttacacagtgcttgttaaagatgccgggggtcaattgatagtggagtatgat
agaccaaagttcatggtacattatttaaccattaatgaagacacacaaaattataagtgt
aacgcacaggttcccattttttttacgatgtctaggttaagtactatggaagatgttgtt
accagggcaatgaagttattttgtgaaagagaatcaagtgttgatatcgatgtaactaac
tttagaacgtggtatataaaggataaaccgtcagcatccgagaatgttaacgactaccta
acgaccaactataaaataaagccatccacgttcgtagagtttcccatgaagcacttaatc
aaatctgaacaactctcatattcaatcaaagactatgattctgaaactattgaccttgct
gtggaactaaaacctcctgctaagaaccagcattgggcatctaactattacatttacaat
cagatgacaccctcaaatggtactgttggtttaggaaatcttggaaatacatgttacatg
aattctgcgttacaatgtcttgttcatattcctgaatttaaggattatttcttgtacaat
gcttatgagaaagaaattaatgtcgataatcccttaggtcacaaaggccatattgcttgg
gcatttggaactttgatccagtctttatttggaaaacgaaataacctcatctcgagttac
tctcccagacattttaaaactacaattggccatttaaactccatgtttgctggataccaa
cagcaagattctcaggagtttctcgcctttttgttagatggtttgcatgaagatttgaac
aggattgtagataagccatacgttgaaaaaccagaattaaaccctacagatgatgtgact
gaattcgagaccatcaaaaagttagcggatgacacatggcttaaacataagctgagaaac
gattcggtaattttggatctatttgtcggcctttacaaatcaacattaatttgtcccaca
tgcaaaaaggtgtcgactacgtttgatccttataatgatttaactttgccgttacctgtg
gacagtacttggtcaaataaggtgctcatttttccacatagttctcctccatacactttt
gaagtcgagttaaataaaaccgacacttattgtgacttaaagaaatatgttgcaagatgt
accggtatgaatacagcagatctgctgggcgctgaagtattcaatcatcaattttataac
aactatgaagcttcacgtgccgattcacaataccttccaatccatgagttaataagtgac
agtgatgtagtggtattctatgaagttcccagaagtgagaatgatttggttgtaccagtt
atgaacaccgtgattgaagatggattcaggtctgcgaaattgtgtggtttcccgtttttc
atttcactttctgaggaagaacaatctgattatggcgtcatattacagaaattagaaaat
gcatttatccaatggtcaggtggtttcacagaatttacattagcatcaaagaaaaacgat
accattacattggaccagctacccgtattgcaaaaaaaatatccaggtttacagccggaa
gctgtagcaaccgagttaaagtatatcaaccctgaacagcctcccgaaaagttctttaaa
ataaagatttacgatgggcagataaataatcagagatctagatttgcttctcagccatat
cctaggtctgcgcgtaacgatctttggacacctgaacctcatgtgacctttagtaaagtt
aaagatatcactgcaaatttagatcaagttttatgggatgcatataactatgcttctatc
ggtttggagggaagcgtggagaatcctaacatcgaatattccggttgcaataacttttgc
gaaagcgaagatgcttccatattaaatgtaacctctcaaaatattggacctcatacgcag
tcgtctgattcagacatggatatcgaagtatccatcgacaaccaagacttacaaaaggct
gaatctagtgaagagcattcattagatctagttgcagataccttgaacgatattcctcgc
gagaaactaattaaggctcaaaatgcgattatctgtgagtggaatagtaaatcgtatgac
gaagtgttcaacagttcattaaaggttaattgggattcacctggggaagtacctaatact
gaattagaagcaagtaaaagagaacggaatgcccaagaagagaagaagattacattgcat
gattgtttaacattgttttcaactccagaggtacttggagctactgattcatggtattgt
ccaagttgtaaagagcatcgccaagcaacaaaacagatcgagttatggaatacccctgat
attttactgatacatttgaaaagatttgaaaatcaaaggtcttttagtgacaaaattggc
gatatagtgcatttcccaattacagatttggatatgtcaccatatcttgtctataaggac
gataaaaaaggtaccatctatgatttaatagctgttgacaatcattatggtggccttgga
ggtggtcactatacagcatatgtcaaaaattttcttgacaacaaatggtattattttgac
gattccagagtaaacgaaacagttcccgaacgtagtatagctggttctgcatatttgtta
ttctatagaagacggacggagtctaattacgtgggaagtcagtatttatgtgatattata
aacaaatctagacaaaaatatgatgaaagaatgaaacaattcaacgatgctgtgctagat
ttgtacactgaaagtagatctgataatgaggatgaaagtgaacacaatcaagaacaatct
ttagaagatgaggaaacagaagatgaagataaacgagaaactgtacatttacttactctt
gcggatggcagagtagaccaacgtggatctattccaatcaaaggcatgattagtccaaat
agtgactatagtatagctagcctggaggtcggcgatggaagtagagttagtggaaatgat
gaagacaatcacaacaatagcaggaggaagttgaggttgttgcaaaagacgtataattca
caatcttctgatattgcatcgccagaatccactccatgctcatcgactgggtcaatttct
gacgagaatactgaaaacacgaaaataggcccaacaagaaatgaaagcattcctgattcc
ccatctgttagctag

DBGET integrated database retrieval system