KEGG   Eremothecium cymbalariae: Ecym_8199Help
Entry
Ecym_8199         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
erc  Eremothecium cymbalariae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Ecym_8199
Enzymes [BR:erc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Ecym_8199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(409794..412781)
Genome map
AA seq 995 aa AA seqDB search
MSGYYNHLNYQGNSRYGLNSLIRNGKYENGNNKYRYSNTSISIDGDRDTNQPSRYQNSST
FPVKQSVTVHLKRPQPVVKWNSQKFTAKYHYFDVHEQKLIHRDKMTSWHSDKLPPMGYVI
VQDTSSGKPRPIMKARNPEEKPLDPRLTPHAETARKARSSLAIMPRIAYDSHSVGPEPPK
EIIIFPVQKVNAASIQDSIIKNFFGTFGEIAHFESFNDPNSALPLNVYLIRYTDLEGNID
GPYRHAYKAVKQFAKQNYLVSGIRFAVKLNKNGMLKKTIDKFVNENVQRAAKVRQELSKQ
QVPSTTGTIATLSPISQSQVAIPTTSPILRIPPDLEKTVNARAVLRVSGKFCVLHGITSE
DFKFGLKNYNWVKIISHYTGIYIIFNEIAEARRCYQMESSHLTLLSRRRRVPVKMKFILI
EPNIKARRLKKPTTEQDIPKTYATVDELVETTLMNILNELKIALHKDIRRRLIGPTVFDS
LNPSNYPDIVSKRQKEQEEKKRLEKLMAEKVKKEHLITEDFGIFNIYGGSYKKKDPTRAI
KRGITGKSEILSSKKRITKKVVTPMAHMLNYESLSKEASSSTNMKEQYSDSSSSEDDYDE
QYELDDIMGQPEAKKLKRESSATTPEPDSIKSKTAGLSEERIKELMSYEEKFRPIPGDIP
EPVYPLEEFEKMDQKISIVNIQKAVKDSEDVDLLKRVLGYKEEAVSNVIEHIEYYAWKLH
RDFEETMKNQETQAKLNEVAYDNSLQSSSGCFKAEGFRKIPDKIKSCYLPHRRRLHQPLN
TVYHHTSDDIYNIDSTKTDTDHQEQDNHTPEPTSSRVNRALQRRFQQDIEAQKAAIGTES
ELLSLNQLTKRKKQVTFARSPIHNWGLYALEPIAAKEMIIEYVGEMIRQPVAEMRENRYL
KSGIGSSYLFRIDEYTVIDATKKGGIARFINHCCDPSCTAKIIKVGGRKRIVIYALRDIA
ANEELTYDYKFEREVDDEERLPCLCGAATCKGFLN
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttattataatcatttaaattaccaaggtaattcgaggtatggtctgaattcg
cttatacggaacggtaagtacgaaaacggcaacaataaataccggtattccaatacgtca
ataagtattgatggagacagagatacaaaccagccttcaagatatcaaaattcaagtact
ttcccagttaagcagagtgtgacagttcatcttaagcggccgcagcctgtagtgaaatgg
aattcgcaaaaattcacagctaaataccactatttcgatgtacacgagcaaaaactaata
caccgagataagatgaccagctggcatagtgacaagcttccgcccatgggctatgttatt
gtgcaggatactagtagtgggaaaccgcgtcccattatgaaggctcgtaatcctgaggaa
aaacctttggatccccgtctcacccctcatgcagagactgcacggaaggcaagatcctca
ttagccatcatgccacgaatagcttacgattcgcattcggttggaccagagccacctaaa
gagattatcatattccccgttcaaaaggttaatgcggcatccattcaagattccataatt
aaaaacttctttggaacctttggtgagattgctcactttgaaagtttcaatgatccgaac
agtgcgctgcccttaaacgtttacctcatcagatacacagacctagagggtaacatagat
ggaccgtacaggcatgcttacaaagcagtgaaacaatttgcaaaacaaaactatcttgtc
tcggggataagatttgctgtgaagctgaataagaatggtatgttaaagaagaccattgac
aaatttgtgaatgaaaacgtgcagcgcgctgcaaaagtgcgccaagagttatcaaaacag
caagtgccatcaactaccggtacaattgctactttgtcccctatatctcagtcacaagtt
gcaataccaaccacgtcccctattttaagaatcccacctgacttggaaaaaacagtcaat
gctagggcagtacttcgcgtatctggtaaattttgcgtattgcatggcatcacaagtgaa
gacttcaagtttgggttaaaaaactataattgggtgaagatcataagccattataccggc
atttacatcatatttaatgagatagctgaagctcgaagatgttatcaaatggagtcttca
catttgacacttttgtctagacgaagaagagtcccggttaaaatgaagttcatattaatt
gagccaaacatcaaagctcgtagattaaagaaaccaacaactgaacaagatatcccaaag
acctatgcaacagttgatgaacttgtggaaactactcttatgaatatcctaaacgaattg
aagattgcattgcataaagatattaggagacgactaattgggccaactgtattcgactct
ttgaatccgtccaattatccagatatagtgtcaaaacgacagaaggaacaggaagagaaa
aagagattagagaaacttatggctgaaaaagtcaaaaaggaacatttaattacagaagat
tttggcatatttaatatttacggaggttcttacaagaagaaggaccctacaagagcaata
aagagaggcattaccggtaaatcagaaatcctttcttcaaagaaacgcataacaaagaaa
gtggtaacaccaatggcacatatgcttaattatgaatctttgtcgaaagaagcttcatct
tcgactaatatgaaggaacaatattcagactcctcatcttctgaagatgattatgatgag
caatatgaacttgatgacataatgggtcagcctgaggccaagaagctaaagcgtgagtca
tctgccactacacctgaaccagatagcatcaaatctaagacggctggcttatctgaagaa
cggataaaggaattaatgtcttatgaagaaaaattcagacctattcctggggatataccg
gaaccagtttatccattggaagagtttgaaaaaatggaccaaaaaatttccattgttaat
atacaaaaagctgttaaagactcggaagatgtagatctcttgaaaagggtattaggctac
aaagaagaagctgtctctaatgtgattgagcatattgaatactatgcatggaaactccat
agagattttgaagaaaccatgaaaaaccaagagactcaggcgaaattgaacgaagtagct
tatgacaattcattacagtcttcttcaggctgttttaaagctgaaggatttagaaagatt
cccgataaaattaaatcttgttacttacctcatcgtcgtaggcttcatcagccgttaaac
acagtgtaccatcatacgtcagatgatatttacaacatagacagtaccaaaacggacaca
gaccaccaagagcaggacaatcacacccctgaaccaacttcatctcgggtgaatagagcc
ttacagagaagatttcaacaagatatagaagcacaaaaggcagccatcggcactgagtca
gaactgttatcattaaaccaattgaccaagcgtaagaaacaagtcacatttgcacgttct
cctattcacaattggggattatatgccttggagcctattgcagccaaggaaatgataata
gaatatgttggtgaaatgatcagacagcccgtagccgaaatgagggaaaatagatacttg
aagagtggcataggttcaagttacttatttcgtattgatgaatacaccgttatcgacgca
accaagaaggggggtattgcccgttttattaatcattgctgtgatcctagttgtaccgct
aagattattaaagttggtggtagaaagagaatagttatatatgctttgcgagacattgct
gctaatgaagaactaacttatgactacaaattcgaacgagaggttgatgatgaagagaga
ttgccgtgcttatgtggagctgcaacctgtaaaggctttttaaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system