KEGG   Eremothecium cymbalariae: Ecym_8239Help
Entry
Ecym_8239         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
erc  Eremothecium cymbalariae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ecym_8239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:487796..492754
Genome map
AA seq 1652 aa AA seqDB search
MKWSTTPFEDLYNSIQGDEFDFVLFKELLPDLNELNLAERFPKSNGSRKQLESGEITLTD
GDTYNLNQEFIISAIQLSDELNLDELVTAELLLLGQGSESDELDQDLSLVNQGKVRFFVR
KQYILQVVSYVVNAHGAGSQTYEALVDNGNLISNILKGFRCIHQQLDEIKQSVNKSQILD
NYDALSQQNVNFKRDFLLKEYDILAQILYGVVNSGSLFNNEGINSIIDHVSTMDSDDFFI
VYYIPALFLAFSKLSKFPEADVKSLHYAFVKELNNETIYTKPVKVALIFVFLTYFIGWCK
AAPTTRAKMFDFETTVDKPMTIAVEQGALEQLMVFSAETSVIEKDKRMELFYDIRSLLER
HIPRLLPKQLLDTEHRSAVVLKSVSNQTSKFNSIMLSEQLEIQLLHVFNDFIQSSISDCA
FLLTKIKNAEEDSLLSGEDLYLDDISAKADLERYFLIIYYFYFCRPELAQSFWQDNESTL
YGFIEWAAKCNDNLMKSCFYLMISSLSYGEENANNVYHYINGNQSLSWGVIAQTISEYII
KISTVEKKLVEMQPQSEEEKTSFNNIALQEGLNEEVVILLSSFLALIGSVAQDVNTEAQL
CLSETFQDILFEFLKVNTPLVGATMEVIGMIVPRLESKREKFWNKLDDWIFKNSPLNATD
DSYHMAFRAVLSNFADVAGFLELFLKMISVETKNDKGYMIFGKLPYPVKLGAGYRKTGIW
PYLDYIFNEVFAHVHHISNPQERAAIIKPIFSIIQCCLYSFDYGVILNSVRAGVSLDSLV
QFGDFFTYAEESSVTAVFNYLFEEKYFKILFKIASVGVDELSGDLDSTENQIHLVRSAIH
IINQILKHENTYLEELCPIIKKRHRETHFIPKNFGLHGLRSYYDAILFNLPLVAHCALYV
GLSDYQLAFESIELLKKISQKLPCGDTRTNKLLTIFESVNESARIKEAFISQLESSIDSE
ESLMLKLAILDFINMNLSYTTTVPTVAHFLLGFQVTNILSLGSNLSTFINSPTSLLNSLV
GILHSSLVAIDHHDVEYAPIKLASVLMEIIVKLCRNTLTSRLVLDFLSSKSLFEKIIQLD
PSVDKTSLWSGQTFNGNFNGTSDQIISSPAIGALLSFLRYRSYVLQYLSLDIHRLSTDAQ
ESKISTSVEALISSAIHAPTIFRFLDILSYSPFPSTNESLKGLNIFGGLDLNIDKIKPSN
KFTGDIYDFDDLDSLLELVVRLQMVPINHEAIDPTSSLAVIAKSEANTIKKFITTYLSHA
SFSSIQLSVLHSWVQLVQILVIDGSMTPVQRSNFILEIFEAIIPKINDYVEFDVSYSEEL
VSLSVFLYDLYQKDRMEIDQEKTIDGRLHGLFKTCVQGITSPLSTLSLRSDFYVLANKYL
LRIIKEEHLAKEVLQSLKMANERLVEVICNDAIAGEGSNRITGILLLDALAQLACLNKVN
FILDALLKSNMLLLIIRSIKTTDELLSLSSHNITLDNLLYELTAFKSTVYFLIRLAKTRN
GSQALVQNEIFQTIESCSFLQIDPDLGLELVFDEVSVRNSNFVRVNLNLDNPLTLGSQAN
GVSLFEVVVPIFQLIASILLSMGSANKPVMKNVKKLLIQYRKLVQGVLKRDALVESNEAY
FVEGSTLEGLQQQVKLVVLLCTLTGYFGEEKA
NT seq 4959 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtctactactccctttgaagacctatacaactcaatccaaggggatgagttt
gactttgttttatttaaggaattgttgccagatttgaatgaattaaatcttgctgaaagg
ttccccaagagtaatgggagtagaaagcaactagaatcgggggaaatcacgttaacagat
ggcgatacttataatctgaatcaagaatttattatttccgcgattcagttatctgatgag
ctaaatctggatgaattggtgactgccgaactgttattactaggtcaaggttctgaatct
gatgaactagatcaggatttatccttggtcaaccaaggaaaagtgcggttctttgtgagg
aagcaatatatcttacaagttgtttcttatgtggtgaatgctcacggagctggtagccag
acatacgaagcattggtagataatggtaacctaattagcaatattttgaaaggtttccgg
tgtattcatcaacagctggatgaaattaaacagtctgttaacaaatcgcaaatactagac
aattatgacgctttgtctcaacaaaatgtgaactttaagcgagactttttgttaaaggaa
tatgatattctcgctcaaatattgtacggtgtggttaacagcggttcattgtttaacaac
gagggcataaattctatcatagatcatgtttcaacgatggattcagatgatttcttcatc
gtgtattacatacctgcgctgtttttggcgttttcgaagctgtccaaatttccagaagcg
gatgtgaaatcactacactatgcgtttgtgaaagaactaaataacgagactatttacacg
aagcccgttaaggtggcgctgatattcgtgtttttgacatattttattggttggtgtaag
gctgctcccactaccagggccaagatgtttgattttgaaaccacagttgataagccaatg
acaattgctgttgagcaaggagctcttgaacaattaatggttttttcagcggaaacttct
gtcatagaaaaagataaaagaatggaactgttttatgatattaggtcgttattggaaagg
cacattccaaggttacttccaaagcaacttttggatacagagcatcgctcggcggtagtt
ctgaaatctgtaagcaatcaaacatctaagtttaatagcattatgttatctgaacagtta
gagatacaactgcttcatgtattcaacgactttattcaatcttcaatatcagattgtgca
ttcctattaactaaaataaaaaatgctgaagaagattccctattatccggtgaagactta
tatctagatgatatttctgcaaaggctgacttggaacgctacttccttataatttattac
ttttatttttgtcgaccagaactggcacagtccttctggcaagataatgagtcaacctta
tatggtttcattgaatgggccgcaaaatgtaatgataacctaatgaagtcctgcttctat
ttaatgatttccagtttgtcttatggtgaagagaatgccaataatgtatatcattatatc
aatggtaatcagtccttatcttggggagttattgctcaaactataagcgaatatatcatc
aaaatatcgactgtggaaaaaaagcttgtggagatgcaaccacaatcggaagaagaaaag
accagtttcaacaatatagctttgcaagaaggtcttaatgaagaagttgtaatcttatta
tcgtcatttttggcacttattggttcggtggcacaagatgtcaatactgaggcgcaattg
tgcttgtcagagacctttcaagatatcctctttgaattcttgaaagtgaatactccattg
gtaggtgctacaatggaagtcattggtatgatagttccacgtttagaatcaaagagagaa
aagttttggaataagttggacgattggatctttaaaaattcacctttgaatgctacggat
gactcgtaccatatggccttccgcgcagtattatcaaattttgcggatgttgctggtttt
ctggagttgtttttaaaaatgatatcggtggaaactaaaaatgataaaggatacatgata
tttggaaagttaccttatccagttaagcttggtgcaggttatagaaaaacgggtatttgg
ccttatttggactatatctttaacgaggtatttgcacacgtccatcatatttccaaccct
caagaaagagccgccattataaagccaatttttagcataattcagtgttgtttgtattca
tttgattacggcgtaattttgaattctgtaagggcaggtgttagtctggattctttggtc
cagtttggagatttttttacctatgcagaagagtcttctgtcactgctgtgttcaattac
ctttttgaggaaaagtacttcaaaatactatttaagattgcttcagttggcgttgacgag
ctttccggtgacttggatagtactgaaaaccagatacaccttgtccgatccgctattcac
attatcaaccaaatattgaagcacgagaatacatatcttgaggaattatgcccaatcatt
aaaaaacgtcatagagagacccatttcattcctaaaaattttggcttacatggtctgcgc
tcctactatgatgctatactcttcaacttgcctctggtagcgcactgtgcactatatgtt
gggttaagtgattatcaattggcatttgagtcaatagagcttctgaaaaaaatttctcaa
aaattaccttgtggtgatacgcggacaaataaactgctaaccatttttgaatctgttaat
gaatctgcaagaattaaggaagcttttattagtcaattagaatcttctatcgactcagag
gaatcattgatgttgaaacttgcaattttagatttcattaatatgaatttgtcatataca
actaccgttccaacagtggctcatttcttgttaggattccaggttaccaatattctttca
ctaggttcaaacctaagtactttcataaattctccgacatccctattaaactccttggtt
ggtatactgcattcgtcattggtagccattgatcatcatgatgttgaatacgctccaatt
aaattagcttctgttttaatggagatcattgttaagttgtgtcgtaatacccttacctcc
cgtttggtgttggatttcctatcgtctaaatcgttatttgagaaaatcattcaattggat
ccaagtgttgacaagacttctctatggtctggacaaacatttaatggtaatttcaatgga
acttctgatcaaattattagtagtccagccatcggtgctctgctatctttcttaagatac
agaagttatgttttacaatatttgagtctggacattcaccgtttatctactgacgctcag
gagtccaagatttcgacctctgttgaagcactcatatctagtgcaattcacgctcctacc
atttttagatttttggatattttgagttatagtccatttccttcaaccaatgaatcgtta
aaaggtctgaatatatttggcggcttagatctgaatattgataaaattaaaccttcaaat
aaatttacaggagatatatatgattttgatgatctggattcattattagaattagttgtt
aggttgcaaatggtccctattaaccatgaagccattgatccaactagttcactcgctgtg
atcgcaaaatctgaggcaaataccatcaagaagttcattacgacatatttgtctcatgca
tctttctcttctattcagctctcagtattacattcatgggttcaactggttcaaattctt
gttatagatggttcaatgacaccagttcagcggtcaaatttcatcttagaaatatttgaa
gctatcattccgaaaattaatgattatgttgaattcgatgtttcgtattcagaagagttg
gtatcattatctgtattcctttatgacctgtaccagaaagaccgtatggaaattgatcaa
gaaaagacgatagatgggagactccatggactgttcaaaacatgtgtacaaggcattaca
tctccattatctacattatctttgagatctgacttttatgttcttgctaataaatatctt
ttgaggatcattaaagaagaacatttggcaaaagaggtattgcaatctctaaaaatggct
aatgaaaggctggtggaagttatctgtaatgatgctatagctggtgagggttcaaatcga
attacaggaatattactactggatgctttggcccaattagcatgcttgaataaggtgaac
tttatactagacgcattactaaagagtaatatgttactactcattatccgttctatcaag
accactgatgaattactaagtttaagttctcataacataacgttggataatttactttat
gagcttaccgctttcaagtccacagtatattttttgattcgtttagctaaaacaaggaat
ggttcacaagcattagttcaaaatgaaatttttcaaactattgagtcatgttcgttcttg
caaattgatcctgacttgggcctggagttagtttttgacgaagtttcagttcgaaattct
aattttgtgcgagtcaatttaaatcttgataatccattgactttaggttcacaagctaat
ggggtttcgttatttgaggtggtagtgcccatttttcaacttattgcatccatcttactc
agtatgggaagtgctaacaaaccagtcatgaagaatgtgaaaaagctgctgatacagtac
agaaaattggtccaaggggtattgaagagagacgctttggtggagagcaatgaagcctat
tttgtcgagggctctactctagaaggtcttcaacaacaggttaagctggtagtactacta
tgcactttgactggatattttggtgaagagaaggcataa

DBGET integrated database retrieval system