KEGG   Eremothecium cymbalariae: Ecym_8337Help
Entry
Ecym_8337         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
erc  Eremothecium cymbalariae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Ecym_8337
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Ecym_8337
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Ecym_8337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:679844..681460
Genome map
AA seq 538 aa AA seqDB search
MDNMAFLFKPPEQRKRNERSPKLSLPTMLVNNSSSSVECQVSGSQSSPIAFSSSTGPKHQ
RQTLRMSSSFSQSTCSPISTTLDSSRLDTGSSPSSPPATAAFKRPAPPSMLTCAILNSDH
NTNQLVGRISSIQQDHDFADRKVYATEVSPVASVSSGQIHQLPYTSNDHSRSIESYPLAG
VATHDSVSSASYLPSPKKLSAEVLPGSSPSSNTDKQDIKVASPLVETKKFNDVDELEEEM
WTHFHLKDQIEELGILGEGAGGSVVKCKLKTGTKIFALKAITTLNSDQESQKQIFRELQF
NKSCKSSFIVQYYGMFTDQEHSSIYIAMEYMGGKSLDAIYKHLLKYGGRVSEKVLGKIAE
SVLRGLSYLHERKIIHRDIKPQNVLLNEAGEVKLCDFGVSGEAVNSLATTFTGTSYYMAP
ERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKMAANMPPIELLMLILTFTPQLKDEP
ESNIAWSKAFKSFIEFCLKKESRERPSPRQMLQHPWIQGQLKRQVNMAKFIQKCWAVK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggataatatggcctttctattcaaaccgcctgagcaaaggaagcgcaatgagagatcc
cctaagctttctttacccacaatgctggtgaataattcatcttcgagtgtggaatgtcag
gtatctggttcccaatcatctccaattgcattttcgtcttctacgggtccaaaacatcag
cgacagacactgcgcatgtcgtcttctttttctcagtctacttgttcgcctatatcgacg
actttagactcgtccagacttgatacaggttccagcccatcatcgccgcctgcaactgca
gcgttcaaaaggcctgctccaccaagcatgttgacttgtgcaattttaaattctgatcac
aatacaaaccaattagttggccgcatatcgtctatacagcaagatcatgactttgcagac
agaaaggtatatgcaacggaggtgtctcctgttgcatcagtttcgagcgggcaaatacac
cagcttccatatacttcgaacgatcatagcaggtccattgaatcgtatcctttagctggg
gttgccacgcatgacagtgttagttctgcaagctatttgccttctccgaaaaagctgtcc
gctgaagtgttgcctggttcttcaccgagcagtaacactgacaaacaggatatcaaagtg
gcgtcacccttagtggagaccaaaaaattcaacgacgttgacgagcttgaggaggagatg
tggactcacttccatttgaaagatcagatcgaagagcttggaatattgggcgaaggagcc
ggtggttctgtcgtcaagtgcaaattgaaaacaggcaccaaaatatttgcattgaaggct
atcaccacgttgaatagcgaccaagagtctcagaagcaaatcttcagagaacttcagttc
aataagagttgcaaatctagcttcatcgttcaatactacggcatgttcactgatcaggaa
cactcttcgatatacattgcaatggaatacatgggcgggaaatcattagacgccatatac
aaacacttactaaagtatgggggaagagttagtgagaaggttcttggcaagatagcggaa
agtgtcttaagaggtctatcctacctacatgaaagaaaaatcatccaccgtgatatcaaa
ccccaaaacgttctattaaacgaagctggtgaagtcaaactatgcgacttcggtgtcagt
ggcgaggcagttaactctctagctacgactttcacaggaacttcctactacatggcccca
gaacgaattcaaggccaaccatacagtgtcacaagcgacgtctggtctcttggtctcaca
ctgctcgaggttgcacaagcccactttccattcgattcgggaaaaatggctgcaaatatg
ccaccaattgagctgctaatgttgatcttaaccttcacaccacaactgaaagacgagccc
gaatctaatatcgcatggagcaaagcattcaaatctttcattgaattttgtctgaagaaa
gagtcacgtgaaagaccttccccaagacaaatgctacaacatccatggattcaaggacag
ttaaagagacaagtgaacatggcaaagttcatccagaagtgctgggcagtcaagtag

DBGET integrated database retrieval system