KEGG   Eremothecium cymbalariae: Ecym_8415Help
Entry
Ecym_8415         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ecym_8415
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ecym_8415
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ecym_8415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:868289..870244
Genome map
AA seq 651 aa AA seqDB search
MTLSKDPMAEIPLIASIDVGTTSTRAILFNKMGQEVSKYQIEYSTTATKDKEAAAAAANG
GDKSPQQNVIFSAEGVAIEANEYVEIEVNDPTLRFPHPGWVECKPMNILANVVQCFAATL
ISINKVNEDRVANNFAPYVITCIGVTNMRETTIVWSKETGLPVVDYGIVWNDTRTMDIVN
AKKSSTTLEESERLRAKTGLPVFSTYFSCSKLRWFLDNVPEVQEAYEKSDLMFGTVDTWL
IYHLTKNHNFVSDVTNASRTGFMNLDTLDYDPELLEYWGIDQTKVNMPKILPSAYHYGDF
CAPEITKNKLTEAAWKVLQDFAVKCVPIQGCLGDQSSSLVGQMAFKAGSAKCTYGTGCFL
LFNTGIKKLISQHGALTTFGYWFPNLEGEEECKPHFVLEGSVAVAGAVVQWLRDNLRLFP
RAEDVGPLASRVPDSGGVVFVPAFSGLFAPYWDSEARGTIMGMSQFTTASHIARAAIEGV
CFQARAILKAMSSDAFGEAAKDSDFLEELVDAGTYEHSPLSILAVDGGMSKSDEVMQIQA
DILGPCVKVRRSPSAECTALGAAIAASMAYENPADRMWKDLEDVKTWIFRGGLSKEEALR
SSDSVSSRLKIFASQSDDKVRRKNWKRWETAIERTKGWLGDAEGSTSTSVN
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgactttgagtaaggatcccatggctgagattccgcttattgcgtcgatagatgtaggc
acgacgtcgactcgtgccatcttgttcaacaagatgggccaggaagtgtcgaagtaccag
atagaatactcgacgacggcgaccaaggacaaggaggcggccgcagcagcggctaacggc
ggggacaagagtcctcagcagaatgttatattttctgcggagggggttgctatcgaggcc
aacgagtatgtggagatagaggtgaatgatcccactctgcggttcccccatccggggtgg
gttgagtgcaagccgatgaacatcttggctaatgtggtgcagtgttttgctgcgacgttg
atttctatcaacaaggtgaatgaggaccgtgttgcgaacaacttcgcaccatatgtgatc
acgtgcattggtgtgaccaacatgagagagacgacgattgtgtggtccaaggagacgggg
ctgcccgtggtggactatggtattgtgtggaatgacacgcgtacgatggacattgtgaat
gcgaagaagagcagcacgacgctggaggagtcggagcgtttgagggccaagacggggctg
ccggtgttttccacgtacttctcatgctccaagttgcgctggtttttggacaacgtgcct
gaagtgcaggaggcgtacgagaagtcggacttgatgtttggcaccgtggacacatggtta
atttaccacttgaccaagaaccacaactttgtgtcggacgttaccaatgcgtccagaacg
gggttcatgaacctggacacgttggactacgaccctgagttgctggagtattggggaatc
gaccagaccaaggtcaacatgcccaagattttgccctccgcttaccactacggcgacttt
tgcgcgccggaaatcaccaagaataagttgactgaggcggcctggaaggtcttgcaggac
tttgcagtcaagtgtgtgccaatccaaggttgtttgggcgaccagagttcttctttggtg
ggccagatggctttcaaggctggttccgccaagtgtacgtacggtaccggatgcttcttg
ttgttcaacacgggtatcaagaaattgatctcacagcacggtgccttgaccacctttggc
tactggttccccaacttagaaggcgaggaagaatgcaagcctcactttgtcctggaaggt
tccgtcgctgtcgccggtgccgtcgtccagtggctaagagacaacttgcgtctgttccct
agagcggaagacgtgggccccttggcatccagagttcccgattctggcggtgttgtgttt
gtccccgccttcagtggtctgtttgctccatactgggactccgaggcgcgtggtaccatc
atgggtatgtcgcaatttaccactgcatctcatatcgcccgtgcagccatcgagggtgtc
tgtttccaggcaagagccatcttgaaggccatgagctccgacgcgtttggcgaagcggcc
aaggacagcgatttcttggaagaactcgtcgacgcaggaacctacgaacattctccgttg
tctatattggccgttgacggaggcatgtccaagtccgatgaagtcatgcaaatacaggcc
gatatcttgggaccttgcgtcaaggtcagaagatccccctccgcggaatgcactgccttg
ggtgcggccattgcggcttccatggcatacgagaaccccgcagaccgtatgtggaaagac
ctagaggacgtcaagacgtggatattccgcggtggtctaagtaaagaggaagcattgcgt
tcgtctgacagcgtctcgtcacggttgaagatatttgccagccagtccgatgacaaagtc
agaagaaagaactggaaacgctgggagacggccattgaacgtaccaagggctggttggga
gatgcagaaggcagcaccagcacctctgtgaactag

DBGET integrated database retrieval system