KEGG   Eubacterium rectale ATCC 33656: EUBREC_0327Help
Entry
EUBREC_0327       CDS       T00909                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EUBREC_0327
   01230 Biosynthesis of amino acids
    EUBREC_0327
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBREC_0327
   00030 Pentose phosphate pathway
    EUBREC_0327
   00051 Fructose and mannose metabolism
    EUBREC_0327
   00052 Galactose metabolism
    EUBREC_0327
  Energy metabolism
   00680 Methane metabolism
    EUBREC_0327
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EUBREC_0327
Enzymes [BR:ere01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EUBREC_0327
Protein phosphatases and associated proteins [BR:ere01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUBREC_0327
Messenger RNA biogenesis [BR:ere03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EUBREC_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297856..298950
Genome map
AA seq 364 aa AA seqDB search
MHKEEAAMKKIGMLTSGGDCQALNAAMRGVVKALAHNIDELEIYGFENGYKGLIYENYRI
LTSKDFSGILTKGGTILGSSRQPFKLMRVPDENGLDKVAAMKNTYKKLGLDCLVILGGNG
TQKTANLLREEGLNIIHLPKTIDNDIYGTDVTFGFQSAINIATDAIDCIHTTAASHNRVF
IVEVMGHKVGWLTLYAGVAGGADIILLPEIPYDIDKVVDAIHKRTKEGKGFTILAVAEGA
ISKEDAALSKKEYRKKLAKSKYPSVSYEVADRISERLGLEVRVAVPGHTQRGGSPCPYDR
VLCTRLGSAAAKAIMDEDYGCMIAMVNGQTKRVPLADVAGKLKTVDPKSQMIKEAKRTGI
CFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggaggaagcagcaatgaagaaaattggaatgcttaccagcggaggagactgc
caggcacttaacgcagccatgagaggtgtggtaaaggcgctggcacacaatatcgacgag
cttgagatttacggctttgagaacgggtacaagggactcatatatgagaactacagaata
ctcacatcaaaggatttttcgggcatcctgacaaagggcggcacaatactcggctcatca
agacagccttttaagcttatgagagtgccggatgagaacggactggacaaggttgcagcc
atgaaaaacacatacaagaagcttggtcttgactgtctcgttattctgggcggaaacggc
acacaaaagacagccaatcttctcagggaagagggacttaatatcattcatctgccaaag
acaatcgacaatgatatctacggcacagatgtgacctttggcttccagagcgcgatcaat
atagctacagatgcaatcgactgcatccacaccacagcagcatcccacaaccgtgtattt
atcgttgaggttatgggccacaaggtaggctggctcacactgtacgcaggtgttgcgggc
ggtgcagacatcattctgcttcctgagataccatacgatattgacaaggtcgtagatgcc
atccacaagagaacaaaggagggcaagggctttaccattcttgcagtagcagagggagcc
atctccaaggaggatgcagccctttccaaaaaggaatacaggaagaagcttgcaaagagc
aaatacccgtcagtatcatacgaggttgcagaccgcatcagcgaaagactcggtcttgag
gtcagagtggcagttccgggacatacacagcgaggcggcagcccatgtccttacgacaga
gtgctttgtacacgtcttggctcagcagcagcaaaggccatcatggatgaggattacggc
tgcatgatagccatggtaaacggacagacaaagagggttccgcttgccgacgtagcagga
aagcttaagactgtagatccaaagagccagatgatcaaggaagcaaagcgcaccggcatc
tgcttcggagattaa

DBGET integrated database retrieval system