KEGG   Eubacterium rectale ATCC 33656: EUBREC_0330Help
Entry
EUBREC_0330       CDS       T00909                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ere00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EUBREC_0330 (recR)
DNA repair and recombination proteins [BR:ere03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EUBREC_0330 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300948..301544
Genome map
AA seq 198 aa AA seqDB search
MDFYSSEISKLIEELSQLPGIGAKTAQRLAFHIINMPKEQAKSLSDAIIDAKEHVRYCKC
CYTLTDDELCPICKDAARDHKTIMVVENTRDLVAYEKTGKYEGVYHVLGGAISPMLGIGP
ADIRLKELMVRLEKDVDEVIIATNSSLEGETTAMYISKLIKPTGIKVTRIASGVPVGGDL
EYIDEVTLLRALQGRTEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggatttttacagcagtgagatatcaaaattaatagaggagctgtcacagcttccggga
atcggagccaagacagcgcagagactggcatttcatatcataaatatgccaaaggagcag
gcaaaatcgctctctgacgccataatcgatgcgaaggagcatgtcagatactgcaaatgc
tgctatacactcacagatgacgagctatgccccatctgcaaggatgcggcaagagaccac
aagaccatcatggttgttgagaatacgagggatcttgtggcatacgaaaagaccggtaaa
tatgagggagtgtatcatgtgcttggtggcgcaatttcacccatgcttggcataggccct
gcagatatccgtctgaaggagcttatggttcgccttgaaaaagacgtagacgaggtcatt
atagcgaccaattcaagcctggagggcgagactacggccatgtatatcagcaagctcatc
aagcctaccggcatcaaagtgacacgaatcgcaagcggagttcccgtaggaggcgatttg
gaatatattgacgaggtgaccctgcttagggcgcttcagggaagaacagagatataa

DBGET integrated database retrieval system