KEGG   Eubacterium rectale ATCC 33656: EUBREC_0461Help
Entry
EUBREC_0461       CDS       T00909                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ere00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ere00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417209..418501
Genome map
AA seq 430 aa AA seqDB search
MEQYVIKGGNPLYGEVEIGGAKNAALAILAAAIMTDETVTIDNLPNVRDINVLLQAIEEI
GAHVERVDIHKVKINGSFIRGVNVDNEFIRRIRASYYLIGALLGKYKHAEVALPGGCDIG
SRPIDLHMKGFRSMGADIDIAHGLVIARAKELKGTHIYMDKVSVGATINIMMAAAMADGK
TVIENAAKEPHVVDVANFLNSMGANIRGAGTDVIRIVGVEKLHATEYSVIPDQIEAGTFM
FAVAAAGGNVLVKNVIPKHLEATTAKLLEVGCQVEEFDDSVRVISDGHLKHTQVTTLPYP
GFPTDMQPQMAVLLGIAEGTSTVTESIFENRFKYVDELTRMGADIKVESNIAIISGVKRY
TGARVNAPDLRAGAALVIAGLAAEGITVVDDIYYIQRGYEALEEKLTKIGAKIARVEDEK
ELQKFILKVS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtacgtaatcaaaggtggaaatcctttatacggtgaagttgaaattggtgga
gccaaaaatgctgcacttgctattttggccgctgccataatgacagacgagactgtaaca
atagataatttgccaaatgtaagggatatcaatgtcttacttcaggcaatcgaagaaatc
ggcgcacatgtggagcgcgtggatatacacaaggtaaagataaacggttcatttatcagg
ggcgtaaatgtcgataatgaattcatcagacgaatcagggcatcatattatttaattggt
gcattacttggaaaatacaagcatgcagaggttgcgcttccgggaggctgtgatatcgga
agcaggccgattgaccttcatatgaagggcttccgctccatgggagcagacatagacata
gctcatggccttgtcatcgccagggcaaaggagcttaagggcacacatatatatatggat
aaggtttctgtaggtgccacaatcaatattatgatggctgcagccatggcagatggcaag
actgttatcgagaatgcggctaaggagcctcatgtcgttgatgtggcaaacttcttaaac
agcatgggagcaaatatcaggggcgcaggaaccgatgtcatcagaattgtaggtgtggag
aaattacatgctacagagtattctgtcattccggatcagattgaggccggtacattcatg
tttgcagttgcggcagcgggaggcaacgtgctggtaaagaatgtcattccaaagcatctt
gaggccaccacagcaaagctgttggaggtaggctgccaggtagaggagtttgatgactca
gtcagagtaatatcagatggacatttaaagcatacacaggtcaccacacttccatatccg
ggcttcccgacagatatgcagccacagatggcggtgcttttgggtatcgctgagggcacc
agtacagtgacagagagcatatttgagaatcgtttcaagtatgttgacgagctcaccaga
atgggagctgatataaaggtagagagcaatatagcaatcatcagcggcgtgaaaagatac
acaggtgccagagtgaatgcacctgacctaagagcaggagctgcactggttatagcaggt
cttgcagcagagggcatcacagtggttgatgatatctactatatccagagaggctatgag
gcactcgaggagaagcttacaaagattggtgcaaagattgccagggtagaggatgagaag
gagcttcagaagttcatactcaaggtatcgtaa

DBGET integrated database retrieval system