KEGG   Eubacterium rectale ATCC 33656: EUBREC_0490Help
Entry
EUBREC_0490       CDS       T00909                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ere00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450673..452160
Genome map
AA seq 495 aa AA seqDB search
MAKSMNNKPMLNAYPDSLGGKLSDIAALLKKKEMQDTFSSFYILPSLYHSDLDRGFSVVD
YNLNEELATIEDLSQLKELGIDLKLDFILNHASAQSPQFKDLVEKGDESEYRDFFIDWNK
FWEGHGVMTDEGYIQPDESCLKQMFFRKPGLPILMVEFPDGRRVPYWNTFYQEVHGRDYL
GQMDLNIKSEKVWDFYRETLKKIASYGAAIVRLDAFAYAPKAPGKKNFLNDPETWEFLQQ
IHELAAPLGLTLLPEIHAAYEEKIYKTLADKGYATYDFFLPGLVIDAIENRRADYLAKWA
REVVEDKISTVNMLGCHDGIPLLDLKGLLPEDDIRSLIDLIVSRGGMVKNLHGQKNIYYQ
VNATYYSALGESDSKMLLARAIQMFMPGKPQVWYLDLFAGKNDHEAVRRAGESGHKEINR
TNLSASDIEEALKKDVVAKQLELLRMRNTHKAFEKGAVITVAGEGPKLSIRYDNGEAYAL
LTVDFEAGAYEIELS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtctatgaacaataaacctatgcttaatgcatatcctgacagtctgggcggt
aagctttccgatatcgcagcgctgctcaaaaagaaggaaatgcaggacacattttcatca
ttttatattctgccaagcctgtatcattcggatttggaccgcggattttcggtcgtggac
tacaatctgaatgaggagcttgcgacaatagaggatttatcgcaattgaaggagctgggg
attgacttaaagcttgactttattttaaatcatgcttcggcacagtcaccacagttcaag
gatcttgtggaaaagggcgatgagtcggagtaccgcgactttttcatagactggaacaaa
ttctgggaaggtcatggagtcatgacggacgagggctacatacagcctgatgagtcatgc
ttaaagcagatgtttttcagaaagccggggcttccgattctcatggtggagtttccggat
ggacgaagggtgccatactggaacacattttaccaggaggtgcatggcagagattatctg
gggcagatggatttaaatataaagtccgaaaaggtgtgggatttctatcgagaaacactt
aaaaaaatagcatcttacggtgcggctattgtgcggcttgatgcatttgcctatgcgcct
aaagcaccggggaaaaagaatttcctgaatgaccctgagacctgggaatttctacagcag
atccatgagcttgcagctccgcttgggctgactctgctgcctgaaatacatgcggcatat
gaggagaaaatatacaaaacccttgcagataagggctatgccacatatgatttcttttta
ccgggactggtaattgatgcgattgagaacaggagagcagattaccttgcaaaatgggcg
cgtgaggttgtggaagataaaatctcaacagtcaatatgcttggctgccatgacggcata
cctcttctggatttaaagggtctgcttccggaggacgatattcgctcgcttatagatttg
attgtatctcgtggcggcatggtcaaaaatcttcatggacagaagaatatatattatcag
gtcaatgccacatattacagtgcgcttggtgagtctgacagcaaaatgcttctggcccgt
gctattcagatgttcatgccgggcaagccgcaggtatggtatctggatctctttgcaggc
aaaaatgaccatgaggcagtaagacgcgcaggagaatcaggacacaaggaaatcaacagg
acaaacctcagtgcctccgatattgaggaggcgctaaaaaaggatgttgttgcaaagcag
cttgagctgcttcgcatgagaaacacccataaggcgtttgagaagggagctgtcatcaca
gtagcaggagaagggccaaagctttcaatccgctatgataacggtgaagcatatgcgctt
ctaacggtggattttgaagccggagcgtatgagatagagctgagctga

DBGET integrated database retrieval system