KEGG   Eubacterium rectale ATCC 33656: EUBREC_0490Help
Entry
EUBREC_0490       CDS       T00909                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUBREC_0490
Enzymes [BR:ere01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EUBREC_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450673..452160
Genome map
AA seq 495 aa AA seqDB search
MAKSMNNKPMLNAYPDSLGGKLSDIAALLKKKEMQDTFSSFYILPSLYHSDLDRGFSVVD
YNLNEELATIEDLSQLKELGIDLKLDFILNHASAQSPQFKDLVEKGDESEYRDFFIDWNK
FWEGHGVMTDEGYIQPDESCLKQMFFRKPGLPILMVEFPDGRRVPYWNTFYQEVHGRDYL
GQMDLNIKSEKVWDFYRETLKKIASYGAAIVRLDAFAYAPKAPGKKNFLNDPETWEFLQQ
IHELAAPLGLTLLPEIHAAYEEKIYKTLADKGYATYDFFLPGLVIDAIENRRADYLAKWA
REVVEDKISTVNMLGCHDGIPLLDLKGLLPEDDIRSLIDLIVSRGGMVKNLHGQKNIYYQ
VNATYYSALGESDSKMLLARAIQMFMPGKPQVWYLDLFAGKNDHEAVRRAGESGHKEINR
TNLSASDIEEALKKDVVAKQLELLRMRNTHKAFEKGAVITVAGEGPKLSIRYDNGEAYAL
LTVDFEAGAYEIELS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtctatgaacaataaacctatgcttaatgcatatcctgacagtctgggcggt
aagctttccgatatcgcagcgctgctcaaaaagaaggaaatgcaggacacattttcatca
ttttatattctgccaagcctgtatcattcggatttggaccgcggattttcggtcgtggac
tacaatctgaatgaggagcttgcgacaatagaggatttatcgcaattgaaggagctgggg
attgacttaaagcttgactttattttaaatcatgcttcggcacagtcaccacagttcaag
gatcttgtggaaaagggcgatgagtcggagtaccgcgactttttcatagactggaacaaa
ttctgggaaggtcatggagtcatgacggacgagggctacatacagcctgatgagtcatgc
ttaaagcagatgtttttcagaaagccggggcttccgattctcatggtggagtttccggat
ggacgaagggtgccatactggaacacattttaccaggaggtgcatggcagagattatctg
gggcagatggatttaaatataaagtccgaaaaggtgtgggatttctatcgagaaacactt
aaaaaaatagcatcttacggtgcggctattgtgcggcttgatgcatttgcctatgcgcct
aaagcaccggggaaaaagaatttcctgaatgaccctgagacctgggaatttctacagcag
atccatgagcttgcagctccgcttgggctgactctgctgcctgaaatacatgcggcatat
gaggagaaaatatacaaaacccttgcagataagggctatgccacatatgatttcttttta
ccgggactggtaattgatgcgattgagaacaggagagcagattaccttgcaaaatgggcg
cgtgaggttgtggaagataaaatctcaacagtcaatatgcttggctgccatgacggcata
cctcttctggatttaaagggtctgcttccggaggacgatattcgctcgcttatagatttg
attgtatctcgtggcggcatggtcaaaaatcttcatggacagaagaatatatattatcag
gtcaatgccacatattacagtgcgcttggtgagtctgacagcaaaatgcttctggcccgt
gctattcagatgttcatgccgggcaagccgcaggtatggtatctggatctctttgcaggc
aaaaatgaccatgaggcagtaagacgcgcaggagaatcaggacacaaggaaatcaacagg
acaaacctcagtgcctccgatattgaggaggcgctaaaaaaggatgttgttgcaaagcag
cttgagctgcttcgcatgagaaacacccataaggcgtttgagaagggagctgtcatcaca
gtagcaggagaagggccaaagctttcaatccgctatgataacggtgaagcatatgcgctt
ctaacggtggattttgaagccggagcgtatgagatagagctgagctga

DBGET integrated database retrieval system