KEGG   Eubacterium rectale ATCC 33656: EUBREC_0616Help
Entry
EUBREC_0616       CDS       T00909                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUBREC_0616
Enzymes [BR:ere01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EUBREC_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563168..564334
Genome map
AA seq 388 aa AA seqDB search
MKKYIALVLAAVLVLGIFTGCGNKGNKETESQTDEKVTESVNSAENNTEDSTQNSTENQN
VADTEQLTTENGQESSVLACPSVNGKLHVEGSKLVDQNNNEVQLRGVSTHGLAWYPQYVT
NDCFATLKSFGANVVRLAMYTYESGGYCTDGDRQQLETLVQNGVQYALNNDMYVIIDWHV
LNEGNPNRYSDVAKTFFAKMAQQYASYNNVIYEICNEPCKGATWGDVKFYASEVIPSIRS
YDKDAVILIGTPNWSQDVDEAVKDPVTGYDNIMYTLHFYAATHKEDLQNKLKSAADAGLP
IFVSEFGICSADGNGQVDIDSANSWISLLDSYGISYVCWNLSNKDEKSALLTPACDKTSG
FIYEDLSDEGKWLYGVLTSHVTQETSGT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatatagcattggtattggctgcagtgctggtgcttgggatttttacagga
tgtggtaacaagggcaacaaggagacagaatcacagacggatgagaaagtcactgagtcg
gtgaattctgcagaaaataatactgaggacagtacgcaaaacagtacagaaaatcagaat
gtggctgacacagagcagctcaccacagaaaacggacaggagagctcagttcttgcctgt
ccgtcagtaaacggtaagctgcatgtggagggcagcaagctcgttgatcaaaataacaac
gaggtgcagcttcgcggagtcagcacacatggtcttgcgtggtatccacagtatgtgacc
aatgattgctttgccacgctgaaaagctttggagcaaacgtggtgaggctcgccatgtat
acctacgaaagcggtggctactgcacagatggtgacaggcagcagcttgagacacttgtg
caaaacggcgtgcagtacgcactaaacaatgacatgtatgtcatcatcgactggcatgtg
ctaaacgagggaaatccaaaccgctacagtgatgtggcaaagacattttttgccaaaatg
gcacagcagtatgcctcatacaacaacgtgatttacgagatttgcaatgagccgtgcaaa
ggtgcgacctggggagatgtgaagttttatgccagcgaggtcattccgtcaatcagaagc
tacgacaaggatgcagtcatactgataggcacacctaactggagccaggatgtggatgag
gcagtcaaggaccctgtcacaggctatgataatatcatgtatacactgcatttctatgcc
gcaacccacaaggaggacttgcaaaacaagctaaaatcggcggcagacgcaggactgccg
atatttgtatcagagtttggcatctgcagcgccgacggaaacggtcaggtggacatagat
tccgcaaacagctggatcagcctgcttgacagctatggcatcagctatgtgtgctggaat
ctgtccaataaggacgaaaaatcagcgcttctaacacctgcctgcgataagacaagcggc
tttatctatgaggatttaagcgatgagggcaagtggctgtacggtgtgctcacaagtcat
gtgacacaggaaacatccggaacatga

DBGET integrated database retrieval system