KEGG   Eubacterium rectale ATCC 33656: EUBREC_0649Help
Entry
EUBREC_0649       CDS       T00909                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00010  Glycolysis / Gluconeogenesis
ere00260  Glycine, serine and threonine metabolism
ere00680  Methane metabolism
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01120  Microbial metabolism in diverse environments
ere01130  Biosynthesis of antibiotics
ere01200  Carbon metabolism
ere01230  Biosynthesis of amino acids
Module
ere_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ere_M00002  Glycolysis, core module involving three-carbon compounds
ere_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBREC_0649
  Energy metabolism
   00680 Methane metabolism
    EUBREC_0649
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBREC_0649
Enzymes [BR:ere01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EUBREC_0649
Membrane trafficking [BR:ere04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EUBREC_0649
Exosome [BR:ere04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EUBREC_0649
  Exosomal proteins of melanoma cells
   EUBREC_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MBD
Motif
Other DBs
NCBI-ProteinID: ACR74438
UniProt: C4ZCT3
Position
588100..588717
Genome map
AA seq 205 aa AA seqDB search
MTRVYFVRHAQPEHDWEEDRTRPLTEEGKKDSAIVLEFLKDKKIDAFYCSPYKRSMDTIA
EAADFFTKEIITDERLREREKGLDGNNHGMFRKRWADHNYHEEGGESIAMVQKRNIEALN
EILSDNTDKDIVIGTHGTALSTILNFYDNNFGCEDFLRIIDWMPYIIELDFESSCNELEF
ECPSYSFKLIGKQEHCYIEKEFKGK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagtttatttcgtgcgtcacgcacagccggaacacgattgggaagaagacaga
acaagacctttgacggaagaaggcaagaaagattctgcaattgttttggaatttttgaag
gataagaaaatagatgcgttttattgtagtccgtataaacgtagcatggatacaattgca
gaggcagcagattttttcacaaaagagattataacagatgagagattgagggagcgtgaa
aagggacttgatggaaacaaccacggaatgttccgaaaacggtgggctgatcacaattat
catgaagaaggtggagagtccattgctatggtgcaaaaacgtaacatagaggcactgaat
gagattttatcagataatacggataaagatattgttataggaacccatggtactgccctt
agtacgatattgaatttttatgacaataattttggatgtgaagattttttaagaattatt
gactggatgccatatattatcgaactggactttgaaagcagctgtaacgaactggaattt
gaatgtccgagttacagttttaagctgattggcaaacaggaacattgttatatagagaag
gaatttaaaggtaagtag

DBGET integrated database retrieval system