KEGG   Eubacterium rectale ATCC 33656: EUBREC_0649Help
Entry
EUBREC_0649       CDS       T00909                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EUBREC_0649
   01230 Biosynthesis of amino acids
    EUBREC_0649
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBREC_0649
  Energy metabolism
   00680 Methane metabolism
    EUBREC_0649
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBREC_0649
Enzymes [BR:ere01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EUBREC_0649
Exosome [BR:ere04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EUBREC_0649
  Exosomal proteins of melanoma cells
   EUBREC_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588100..588717
Genome map
AA seq 205 aa AA seqDB search
MTRVYFVRHAQPEHDWEEDRTRPLTEEGKKDSAIVLEFLKDKKIDAFYCSPYKRSMDTIA
EAADFFTKEIITDERLREREKGLDGNNHGMFRKRWADHNYHEEGGESIAMVQKRNIEALN
EILSDNTDKDIVIGTHGTALSTILNFYDNNFGCEDFLRIIDWMPYIIELDFESSCNELEF
ECPSYSFKLIGKQEHCYIEKEFKGK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagtttatttcgtgcgtcacgcacagccggaacacgattgggaagaagacaga
acaagacctttgacggaagaaggcaagaaagattctgcaattgttttggaatttttgaag
gataagaaaatagatgcgttttattgtagtccgtataaacgtagcatggatacaattgca
gaggcagcagattttttcacaaaagagattataacagatgagagattgagggagcgtgaa
aagggacttgatggaaacaaccacggaatgttccgaaaacggtgggctgatcacaattat
catgaagaaggtggagagtccattgctatggtgcaaaaacgtaacatagaggcactgaat
gagattttatcagataatacggataaagatattgttataggaacccatggtactgccctt
agtacgatattgaatttttatgacaataattttggatgtgaagattttttaagaattatt
gactggatgccatatattatcgaactggactttgaaagcagctgtaacgaactggaattt
gaatgtccgagttacagttttaagctgattggcaaacaggaacattgttatatagagaag
gaatttaaaggtaagtag

DBGET integrated database retrieval system