KEGG   Eubacterium rectale ATCC 33656: EUBREC_0728Help
Entry
EUBREC_0728       CDS       T00909                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ere00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EUBREC_0728
Enzymes [BR:ere01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EUBREC_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669675..671894
Genome map
AA seq 739 aa AA seqDB search
METETVTGYVDHIIYRNAENGYTVLVLVVNEEELTCVGTFSDIAEGENIEAHGEYTEHAT
YGRQFKVVSFEEKEPEDEMAIERYLGSGAIHGIGLALAARIVRRFKKDTFRIIEEEPERL
AEVKGISQRKAMEIADQVNAKRDLREAMIFLQQYGINMNLAVKIYNKYGGEIYSVLKENP
YRMADDIDGVGFKTADEIAARVGIKTDSDFRIKSGIQYVLQQAAMDGHTYLPMEELTRRA
VYLLGVESSQVEAHYMNLAMDRKIVMQLKDDITQIYANTFYYMEANTAAMLKQLDVTYDV
PDIEIEAAIRNIEKKTEMELDEHQVEAVKEAVRNGLLVITGGPGTGKTTTINTIIKYFEL
EGMDIFLAAPTGRAAKRMSETTGYEARTIHRMLELNGGMDTGSAAGFERNERNPLETDVI
IIDEMSMVDISLMYSLLKAVVAGTRLILVGDVNQLPSVGPGSVLKDIIDSGAFHTVKLTK
IFRQASTSDIIVNAHKINNGEEVSLDNKSMDFFFLKRYDADKIINVTLQLIKQKLPKFIN
ATEYDIQVLTPMRKGLLGVERLNGILQAYMNPADKSKREKEYRGTIFREGDKVMQIKNNY
QIEWEIRTKFGLCVDKGMGIFNGDTGIIEEINDFAETMTISFDEGRKVEYPFKLLEELEL
AYAVTIHKSQGSEYPAVVIPLLSGPRMLMNRNLLYTAVTRAKKCVTIVGDEQTFYEMIQN
NSQQRRYSGLRDRIVEETI
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaccgaaacagtcacaggatacgttgatcatataatatacagaaatgcagaaaac
gggtatacagtacttgttcttgtagtgaacgaggaggagctcacatgtgtgggcactttt
tcggacattgctgagggggaaaatatagaggctcacggtgagtatacagagcatgccaca
tatggcagacagtttaaggtagtaagctttgaagagaaggagccagaggatgagatggct
attgagaggtatctgggctcaggagccatacatggtataggacttgcactcgcagcacgt
attgtcaggcgattcaagaaggataccttccgcatcatagaggaagagccggagaggctt
gctgaggtaaagggcatcagccagagaaaggctatggagattgcggaccaggtcaatgca
aaaagagacttaagggaagccatgatttttttgcagcagtacggcatcaatatgaatctg
gctgtgaagatatataataagtatggcggagagatatacagcgtgctcaaggaaaatccg
taccgcatggcggatgatatcgacggagttggttttaaaactgcagatgagatagcggcg
cgggttggcatcaagactgattctgattttagaataaaaagcggtatacagtatgttttg
cagcaggctgccatggacggacacacatatctgccgatggaggaacttacgaggcgtgct
gtatatctgctcggagtggaaagctcgcaggttgaggcacattacatgaatctggccatg
gacaggaagattgtcatgcagctaaaggatgatataacccagatttatgctaacaccttt
tattatatggaggcaaacacggcagccatgctaaagcagcttgatgtgacgtatgatgtg
ccggatatcgagatagaggctgcaatcagaaatatagagaaaaagacagagatggagctc
gatgagcaccaggtagaggcggtgaaggaagcagtcagaaatggccttttagtcattacc
ggaggacccggaacaggaaaaaccaccaccatcaatactattatcaagtattttgagctg
gagggcatggatatttttctggctgcaccgacaggccgtgcggcaaaacgcatgagtgag
acaacaggctacgaggcacgcacaatccaccgtatgcttgagttaaacggcggcatggac
acaggaagcgcagctggctttgagagaaatgaaaggaatccgctcgagacggatgtaatc
atcatagatgagatgtcgatggttgatatatcactcatgtactcattgctaaaggcggtt
gtggcaggtacgagactcatacttgtaggagatgtgaaccagcttccgagcgtgggaccg
ggcagcgtgctaaaggatattattgattcaggtgcattccacacggtaaagcttacaaag
atttttcgtcaggcgagcacgagcgatattatagtaaacgcccacaagataaataatgga
gaagaggtatcgttagataataagagcatggatttcttttttctaaagagatatgatgcc
gacaagataataaatgttacattacagctaataaagcagaagcttcctaagtttataaat
gctacagagtatgatatacaggtgcttacgcctatgagaaaggggcttctcggagtggaa
cgtctaaacggtatattgcaggcgtatatgaatccggcagacaagagcaagcgcgaaaaa
gaatacaggggcacgattttccgcgagggcgacaaggtgatgcagataaagaacaactat
cagatagagtgggaaatcaggacaaaattcggactttgtgtggataagggcatgggaatc
ttcaatggagatacaggtatcattgaggaaatcaatgattttgccgagaccatgaccata
tcctttgacgagggcagaaaggtggagtatccgtttaagcttttggaggagcttgaactt
gcatacgcggtcactatacacaagtcgcagggaagtgagtatccggcggtcgttatacct
cttttgagcggtccgagaatgcttatgaacagaaatttgctctatacggcggttacaaga
gcaaagaaatgtgttaccatagtgggtgatgaacagacattttatgagatgatacaaaac
aactcacagcagagacgctatagcgggcttagagacagaatagtggaggagactatctga

DBGET integrated database retrieval system