KEGG   Eubacterium rectale ATCC 33656: EUBREC_0904Help
Entry
EUBREC_0904       CDS       T00909                                 

Definition
porphyrin biosynthesis protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ere00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807609..809174
Genome map
AA seq 521 aa AA seqDB search
MRENTGKVVLVGAGPGDTGLLTLKGEKYIKQADCLVYDRLSSPEFLSMAKAGCELIYVGK
ENHKHVMKQDAINELLYEKSKYHELVVRLKGGDPYVFGRGGEEALYLVDRNVEVEVVPGV
SSSVAALAAAGIPITHRGIAKGFQVITAHSRKDEEADIDYSLLTDETITCVFLMGLAHVK
SIAAGLMKAGRRADTPAAVISNGTLAAQRKCIGTLADIGEKIEEAKLTSPAIIVVGDVVS
LNDRLDFFEKRPLFGRKITVPYIKTNELIAKLQQLGADITPVKTGIIKPVIIPKFVDKVR
SADWIVFTSKNGVRSFFYNLDLAGADIRLIANARFAVVGKATEKELVKHHINADIIPAEQ
TGKGLADAMKLCMPYAYGVSDEDTFDLGKNSTLDLSNDNISDKMCKVCIFSAKEASPDLE
AGLKEICELEKIDAYVNEQAYEGIPESIGNMVSEAVFTSASNVERFFHMLPENAYVETAY
SIGEKTTAALEQHNVREIVQADDSSYEALVDKISYKDAFKD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaacacaggaaaagtagtattagttggagcaggaccgggagatacgggcctg
ctcactttaaaaggagaaaaatatataaaacaggcggattgtctggtgtatgacagacta
tcatcaccagagtttctttcaatggcaaaggcaggctgtgagcttatttatgtgggcaag
gaaaatcacaagcatgtcatgaagcaggatgccataaacgagcttttatacgagaaatca
aaatatcatgagcttgtagtccgtttaaagggcggagatccgtatgtctttggaagaggc
ggagaggaagctctctacctggtagatagaaatgtggaggtagaagtggtaccgggtgtc
agttcatcggttgcagcgcttgcggctgcaggaatacctatcacacacagaggcatagca
aaaggctttcaggtcatcactgcgcacagcagaaaggatgaggaggcagatatagactat
tcccttcttacagatgagacaatcacctgcgtatttttgatgggacttgcgcatgtaaaa
agcattgcagcagggcttatgaaagcaggacgaagagcggatactccggcagcagtgata
tcgaacggcacacttgccgcgcagcgcaaatgtataggaacgcttgcggatatcggagaa
aaaatcgaggaagcaaagctgacatcaccggctataatcgttgtgggagatgtggtttca
ctgaatgacaggcttgatttctttgaaaaaagaccgctgtttggaagaaaaatcacagta
ccatatatcaaaacaaacgaattgatagcaaaattacagcagcttggagcagacatcaca
ccggttaaaacaggcataattaaaccagttataattcctaaatttgttgataaagtaaga
tcggcagactggatagtttttacaagcaaaaatggtgtaagatcatttttctataatctg
gatctggcaggggctgacatcaggcttatagcaaatgcaaggtttgcggtggtgggaaaa
gctacagaaaaagagcttgtaaagcatcacataaatgcagatattattccggcagaacag
accggaaaaggacttgcagatgcaatgaaattatgtatgccgtatgcctatggagtaagt
gatgaggatacatttgatttagggaaaaatagtacattggatttaagcaatgataatata
tctgataaaatgtgtaaagtctgcattttctcggcaaaggaggcttcacctgaccttgag
gcagggcttaaagaaatatgtgaattagaaaaaattgatgcatatgtaaatgagcaggca
tatgagggtattcctgaaagcattggaaacatggtaagtgaagctgtttttacaagcgca
tcaaatgtggaaagattttttcatatgctgccggagaatgcatacgtggaaacagcatac
tcaataggtgaaaaaacaacagcagcattagagcagcacaatgtcagagagatagtacaa
gctgatgatagcagttatgaagcgctggtagataaaatatcttataaagatgcttttaaa
gattaa

DBGET integrated database retrieval system