KEGG   Eubacterium rectale ATCC 33656: EUBREC_0999Help
Entry
EUBREC_0999       CDS       T00909                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00900  Terpenoid backbone biosynthesis
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01130  Biosynthesis of antibiotics
Module
ere_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EUBREC_0999
Enzymes [BR:ere01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EUBREC_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACR74761
UniProt: C4ZGG4
Position
894538..895419
Genome map
AA seq 293 aa AA seqDB search
MGSNNDISLKALAKINLGLDVVRRREDGYHEVRMIMQTIHLYDRLDIKRTKEPGIQIQTN
LSFLPVNENNLIYKAAKLLMDEFSITDGVSVKLDKRIPVAAGMAGGSTDAAAMLIGVNRL
FSLGLTKRQLMERGVQIGADVPYCIMRGTALAEGIGEALSPLPPMVKCPVLIAKPSISVS
TKFVYQNLKLDDTTIHPDIDHLIDDIKAKNLHDIAAHMGNVLETVTIPNYPVIDEIKKHM
LSNGAVGAMMSGSGPTVFGLFDDEDTAKKAYKAMRSSHLARQVYLTSVYNNRK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtaataacgatatttcattaaaagcattagccaagattaatctggggctcgat
gttgtgaggcgcagagaggacggatatcatgaggtccgtatgattatgcagaccattcat
ctgtatgacaggcttgatatcaaaaggacaaaggagccgggcatacagatacagaccaat
ctgtcttttctccctgtaaacgagaacaatctcatatacaaggctgcaaagcttctgatg
gatgagttttctataactgacggtgtatcagtgaagctggacaagcgtattcctgttgca
gcagggatggcggggggcagtactgatgcggcagctatgcttataggtgtaaacaggctt
ttttcactgggactgacaaagagacagcttatggaaagaggtgtgcagataggtgcggat
gtaccatactgtattatgagaggcacggcgctggccgagggcataggagaggcgcttagt
cctcttcctccaatggtaaagtgtccggtgcttattgcaaagccgtccatctcggtatcc
acaaaatttgtgtatcagaatctgaagcttgatgatacgactattcatccggatatagac
cacctgatagatgatataaaggctaagaatctgcatgatatcgcagcgcatatgggaaat
gtcttagagactgtgaccataccaaattatccggtgatagatgagataaagaagcatatg
ctttcaaatggcgcggtaggagccatgatgagcggtagtggtccgacggtttttggtctg
tttgacgatgaagatactgcaaagaaagcgtacaaagccatgagaagctcacatcttgcc
agacaggtgtatctgacatctgtatacaataatcgcaaataa

DBGET integrated database retrieval system