KEGG   Eubacterium rectale ATCC 33656: EUBREC_1249Help
Entry
EUBREC_1249       CDS       T00909                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ere00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ere00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146228..1146719
Genome map
AA seq 163 aa AA seqDB search
MNLIAAVDNNWAIGKNNQLLVRIPMDQKFFREMTTGKVVVMGRKTLESFPNSRPLKNRTN
IVLTHNPSYEVEGAVVVHSLDELHKELEKYNSEDIYIIGGQKIYEQLVDECDVAHITKVD
FEYDADAYFPNLDEKPEWQITGDSEEQTYFDLEFYFLRYEKVK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagcagcagttgacaataactgggcaattggaaaaaataaccagttgctc
gttcggatacctatggaccagaagtttttccgcgagatgactacaggaaaggttgtagtc
atgggcagaaagacacttgagagctttccaaacagcagacctcttaagaacagaaccaac
atagtgctcacacataacccatcctatgaggtggagggtgctgtcgtggttcactcactt
gatgagcttcacaaggagcttgaaaaatacaattctgaggatatttatatcattggtgga
cagaaaatttatgagcagctcgtggatgaatgcgatgtagcccacatcacaaaggtggac
ttcgagtatgatgcggatgcatattttccaaatcttgacgagaagcctgagtggcagatt
acgggagacagcgaagagcagacatactttgatttggagttttatttccttcgatatgag
aaagtaaaataa

DBGET integrated database retrieval system