KEGG   Eubacterium rectale ATCC 33656: EUBREC_1249Help
Entry
EUBREC_1249       CDS       T00909                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EUBREC_1249
   00670 One carbon pool by folate
    EUBREC_1249
Enzymes [BR:ere01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EUBREC_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146228..1146719
Genome map
AA seq 163 aa AA seqDB search
MNLIAAVDNNWAIGKNNQLLVRIPMDQKFFREMTTGKVVVMGRKTLESFPNSRPLKNRTN
IVLTHNPSYEVEGAVVVHSLDELHKELEKYNSEDIYIIGGQKIYEQLVDECDVAHITKVD
FEYDADAYFPNLDEKPEWQITGDSEEQTYFDLEFYFLRYEKVK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagcagcagttgacaataactgggcaattggaaaaaataaccagttgctc
gttcggatacctatggaccagaagtttttccgcgagatgactacaggaaaggttgtagtc
atgggcagaaagacacttgagagctttccaaacagcagacctcttaagaacagaaccaac
atagtgctcacacataacccatcctatgaggtggagggtgctgtcgtggttcactcactt
gatgagcttcacaaggagcttgaaaaatacaattctgaggatatttatatcattggtgga
cagaaaatttatgagcagctcgtggatgaatgcgatgtagcccacatcacaaaggtggac
ttcgagtatgatgcggatgcatattttccaaatcttgacgagaagcctgagtggcagatt
acgggagacagcgaagagcagacatactttgatttggagttttatttccttcgatatgag
aaagtaaaataa

DBGET integrated database retrieval system