KEGG   Eubacterium rectale ATCC 33656: EUBREC_1460Help
Entry
EUBREC_1460       CDS       T00909                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EUBREC_1460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBREC_1460
   00030 Pentose phosphate pathway
    EUBREC_1460
   00051 Fructose and mannose metabolism
    EUBREC_1460
  Energy metabolism
   00680 Methane metabolism
    EUBREC_1460
Enzymes [BR:ere01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EUBREC_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337776..1339749
Genome map
AA seq 657 aa AA seqDB search
MNDIAIDKEHLHYLEQLSEMYPTIGKASSEIINLQAILNLPKGTEHFVSDVHGEYEAFSH
VLKNGSGAVRKKIDDVFGLAMDKADKAALATLIYYPREKMELIKQDEPDMDSWYKTTLYK
LIEVCKTVSSKYTRSKVRKALPEEYAYVIEELITEKPEVLNKEAYYESIINTTVELGTAE
EFIVVLSELIQRLAVDHLHVLGDIYDRGAGPHLIMDRLCRYHSLDIQWGNHDIIWMGAAA
GNPACIATVVRNSIRYGNLDVVEEGYGINMLPLATFALKAYKDDPCTRFVFKVAPSGADN
MESDLIKKMHKAIAIIRFKLEGQLIKKWPEYGMKERLLLEHIDYEQGTIDLEGRTYKLLD
TSFPTIDPADPYRLTEGEEEVIQRLRSSFIHCEKLKNHVGLLLKRGSMYKVYNGNLLFHG
CIPMEEDGSFAKVNIYGKEYSGKALFDILETYVRKAFFSDDRLERQKGSDIMWYIWTAPY
SPLYGRNKMATFERYFIDDDDMKIEKKNFYYEYINKPECAQRILEEFGLHDKRDHIINGH
VPVHRLRGESPVKCDGRVIVIDGGFSKAYRRRTGIAGYTLIYNSYGLTLTAHEPFESPET
AVRDERDIVSRREAVEVLDKRILVGDTDAGIKMKEKIADLKHLIAAYRSGEIAERDD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatatagcaattgataaagaacacttacattatttggaacagctgtcggagatg
tatccgacaataggcaaggcatcatctgagattatcaatctgcaggctattttaaacctg
ccaaagggcacagagcactttgtatctgatgtgcatggtgagtatgaagccttttcccat
gtgctgaaaaatggttctggggctgtaagaaagaagatagatgatgtatttggtctggcg
atggacaaggctgacaaggctgcgcttgccacactcatctactacccaagggaaaagatg
gagcttattaagcaggacgagccggatatggactcgtggtataagacgactctttataag
ctgatagaggtgtgcaagaccgtttcgtcaaagtatacgcgctccaaggtgagaaaagct
ttgccggaggagtatgcatatgttatagaggagctcatcacagaaaagccggaggtgtta
aacaaggaggcttactacgagtcaatcatcaatacaacagtggagctgggtactgcggag
gagtttatagtggtgctttcagagcttattcagagacttgctgttgaccatctgcatgtg
cttggtgatatatacgacaggggagcggggccgcatctgataatggacaggctgtgcaga
tatcactcgctggatatacagtggggcaatcacgatattatctggatgggggcagccgca
ggaaatcctgcatgtattgcaactgttgtcagaaacagtatcagatatggtaatctggac
gtggtcgaggagggctatggcataaatatgcttccgcttgctacgtttgcactgaaggct
tacaaggatgacccatgcaccagatttgtgtttaaggtggctccaagtggcgcagataat
atggagagtgatctgataaagaagatgcacaaggccattgccatcatacgtttcaagctg
gagggacagctcattaagaagtggcctgagtatggcatgaaggaacgattgcttttggaa
catattgattatgaacagggcactatagatcttgagggcagaacttataagctgcttgat
acaagctttccaacaattgacccggctgatccttacaggctgacagagggggaagaggaa
gtcatacagaggctcaggagctcgtttattcattgcgagaagcttaaaaaccacgttggg
ctgctgcttaaaagaggcagcatgtacaaggtatataatggcaatctgcttttccacgga
tgcatccccatggaggaggatggaagcttcgcaaaggtaaatatctacggtaaagagtat
agtggcaaggctttgtttgatatactggagacttacgtcagaaaggcttttttctcggac
gacaggctggaaagacaaaagggcagcgatatcatgtggtacatatggacagcaccatat
tctccgctttatggcagaaataagatggctacgtttgagagatattttatagatgacgat
gatatgaaaatagaaaagaaaaacttttattatgagtatataaacaagcctgagtgtgcg
cagcgtatactcgaggagtttggtttgcatgataaaagagaccatatcataaacggacat
gttcctgtacacagattaagaggtgaaagccctgtgaagtgcgacggcagagtgatagtc
atagatggtggtttttcaaaggcgtaccgcaggcggacaggcatcgcgggatataccttg
atttacaattcatatgggctgacattgacagcgcatgagccgtttgaatcaccggagacg
gcagtaagggatgagagggatatcgtatcaaggcgtgaggctgtagaggtacttgataag
agaatacttgtcggagatacggatgccggaataaagatgaaggaaaagatagctgatcta
aagcatctcattgcggcatatcgttcgggtgagattgcagagcgcgatgattag

DBGET integrated database retrieval system