KEGG   Eubacterium rectale ATCC 33656: EUBREC_1478Help
Entry
EUBREC_1478       CDS       T00909                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ere00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ere00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1359216..1360703
Genome map
AA seq 495 aa AA seqDB search
MGENKMKLEKLLERMDYKVLAGSTDIEISTLVYDSRKVEKASVFVCISGAVSDAHDFIPD
VVKKGAAAVVVEKDVTPIEGVTYIKVDNTRLALACMSAAYFDYPAEKIKTIGITGTKGKT
TTTYMVKSILESAGIKTGLIGTIESICGDKRIPSANTTPESYRVQELFKEMVDEGLDAVV
MEVSSQALMLHRVSGFTFDIGVFTNLEPDHIGEHEHKDFADYMHCKSLLFRQCRLGIFNG
DDEHLEGVMKGHTCQVETYGYKSTNNLIAENVELKKEHGALGVKYHVSGLLDFDVEVNVP
GKFSVYNSLTAIAICHHFNVDKKAIGEALHHVSVKGRIEIVPVTKRYTLMIDYAHNAMAL
ESLLTTLKEYEPGRLVCLFGCGGNRAKSRRYEMGEVSSRLADLTVVTSDNPRDEEPMDII
NDILQGVHKADGEYVTIPDRKEAIRYCMENAKDGDIIVLAGKGHEDYQEIKGVKHHMDER
ELIADIIKENPDIRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaataaaatgaagcttgaaaaattacttgaaagaatggattataaagtatta
gcaggaagcacggatatagagatttccacactcgtgtatgactcgcgcaaggtggagaag
gcatcggtatttgtgtgcatatcgggagctgtgtcagatgcacatgatttcatccctgat
gtggtaaagaaaggtgcagcggcagtggttgtcgaaaaagatgtgactcctatcgaaggg
gtgacatatattaaggtagataatacaaggcttgcacttgcgtgtatgtcagcagcttat
tttgattatccggccgagaagataaagactatcggtattacaggtacaaagggtaagacc
actaccacatatatggtaaagtcaattcttgagtcagccggcataaagacaggacttatc
ggtacaatagagtctatatgtggtgacaagagaattccgtcagcaaataccacacctgag
tcatacagagttcaggagctgtttaaggagatggtggatgaaggccttgatgcagttgtt
atggaagtgtcatcacaggctctaatgcttcacagagtatcgggctttacctttgatatc
ggtgtatttacaaatcttgagcctgaccacatcggagagcatgagcacaaggattttgca
gactacatgcattgcaagagtcttttattcagacagtgcaggcttggtatctttaacgga
gatgatgagcacttagagggtgttatgaagggacacacatgccaggtggagacttacggc
tacaagtccacaaacaacctgatagcagaaaatgttgagcttaaaaaggagcatggagca
ctcggcgttaaatatcatgtatcagggcttctggattttgatgtggaggtcaatgtgccg
ggcaaattctcagtatacaattcactaacagccattgctatctgccatcatttcaatgtg
gataaaaaggcaatcggggaggctcttcatcatgtgagtgtaaagggcagaatagagatt
gttcctgttacaaagagatatacccttatgattgattatgcacacaatgcgatggcactt
gaaagccttctcaccactcttaaggagtatgagccgggaagacttgtatgcctgtttggc
tgtggcggaaacagggcaaagtcacgccgttatgagatgggagaggtgtcatcgagactt
gcagaccttactgttgtcacatccgataatccaagagatgaggagcctatggacataatc
aatgatattttacagggtgtacacaaggcagatggagagtatgtgacaattcctgaccgt
aaggaggctatcagatactgcatggagaatgccaaggatggtgatatcatagtacttgca
ggaaagggccatgaggattatcaggagataaagggtgtgaagcatcacatggatgagaga
gaattaattgctgatataataaaagaaaatcctgacatcagactttaa

DBGET integrated database retrieval system