KEGG   Eubacterium rectale ATCC 33656: EUBREC_1478Help
Entry
EUBREC_1478       CDS       T00909                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EUBREC_1478
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EUBREC_1478
Enzymes [BR:ere01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EUBREC_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1359216..1360703
Genome map
AA seq 495 aa AA seqDB search
MGENKMKLEKLLERMDYKVLAGSTDIEISTLVYDSRKVEKASVFVCISGAVSDAHDFIPD
VVKKGAAAVVVEKDVTPIEGVTYIKVDNTRLALACMSAAYFDYPAEKIKTIGITGTKGKT
TTTYMVKSILESAGIKTGLIGTIESICGDKRIPSANTTPESYRVQELFKEMVDEGLDAVV
MEVSSQALMLHRVSGFTFDIGVFTNLEPDHIGEHEHKDFADYMHCKSLLFRQCRLGIFNG
DDEHLEGVMKGHTCQVETYGYKSTNNLIAENVELKKEHGALGVKYHVSGLLDFDVEVNVP
GKFSVYNSLTAIAICHHFNVDKKAIGEALHHVSVKGRIEIVPVTKRYTLMIDYAHNAMAL
ESLLTTLKEYEPGRLVCLFGCGGNRAKSRRYEMGEVSSRLADLTVVTSDNPRDEEPMDII
NDILQGVHKADGEYVTIPDRKEAIRYCMENAKDGDIIVLAGKGHEDYQEIKGVKHHMDER
ELIADIIKENPDIRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaataaaatgaagcttgaaaaattacttgaaagaatggattataaagtatta
gcaggaagcacggatatagagatttccacactcgtgtatgactcgcgcaaggtggagaag
gcatcggtatttgtgtgcatatcgggagctgtgtcagatgcacatgatttcatccctgat
gtggtaaagaaaggtgcagcggcagtggttgtcgaaaaagatgtgactcctatcgaaggg
gtgacatatattaaggtagataatacaaggcttgcacttgcgtgtatgtcagcagcttat
tttgattatccggccgagaagataaagactatcggtattacaggtacaaagggtaagacc
actaccacatatatggtaaagtcaattcttgagtcagccggcataaagacaggacttatc
ggtacaatagagtctatatgtggtgacaagagaattccgtcagcaaataccacacctgag
tcatacagagttcaggagctgtttaaggagatggtggatgaaggccttgatgcagttgtt
atggaagtgtcatcacaggctctaatgcttcacagagtatcgggctttacctttgatatc
ggtgtatttacaaatcttgagcctgaccacatcggagagcatgagcacaaggattttgca
gactacatgcattgcaagagtcttttattcagacagtgcaggcttggtatctttaacgga
gatgatgagcacttagagggtgttatgaagggacacacatgccaggtggagacttacggc
tacaagtccacaaacaacctgatagcagaaaatgttgagcttaaaaaggagcatggagca
ctcggcgttaaatatcatgtatcagggcttctggattttgatgtggaggtcaatgtgccg
ggcaaattctcagtatacaattcactaacagccattgctatctgccatcatttcaatgtg
gataaaaaggcaatcggggaggctcttcatcatgtgagtgtaaagggcagaatagagatt
gttcctgttacaaagagatatacccttatgattgattatgcacacaatgcgatggcactt
gaaagccttctcaccactcttaaggagtatgagccgggaagacttgtatgcctgtttggc
tgtggcggaaacagggcaaagtcacgccgttatgagatgggagaggtgtcatcgagactt
gcagaccttactgttgtcacatccgataatccaagagatgaggagcctatggacataatc
aatgatattttacagggtgtacacaaggcagatggagagtatgtgacaattcctgaccgt
aaggaggctatcagatactgcatggagaatgccaaggatggtgatatcatagtacttgca
ggaaagggccatgaggattatcaggagataaagggtgtgaagcatcacatggatgagaga
gaattaattgctgatataataaaagaaaatcctgacatcagactttaa

DBGET integrated database retrieval system