KEGG   Eubacterium rectale ATCC 33656: EUBREC_1648Help
Entry
EUBREC_1648       CDS       T00909                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUBREC_1648
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EUBREC_1648
Enzymes [BR:ere01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EUBREC_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535465..1536379
Genome map
AA seq 304 aa AA seqDB search
MRNVIMYAFRLTIGKMIEMSFLDNYKRVVIKIGSSTLTHAETGSLNFSKMERLVRSICDY
RNSGMDVCLVSSGAIAVGRDVIGIKERPSDISIKQACAAVGQGRLMMTYQKLFSEYNQNS
GQVLMTKNTIVNPVSRRNVMNTFEELFDLNVVPIVNENDTVSTYEMQFGDNDTLSAIVTS
ITKADLLILLSDIDGLYSDDPHDNPDAKLIREVDTLDRKILGMAKSSTGSDVGTGGMATK
LTAAKIATYSGADMIIANGGNMGILYDIMNDRYTGTLFHRAKDAEFVLADYIQREMAPTS
TGGQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgtaattatgtatgcatttagacttacaataggaaagatgatagaaatgagt
tttttggacaattataaaagagtggtaataaagataggttcatcgacgctgacacatgca
gagacgggaagcctcaatttttcaaagatggagcgtctggtgcgctcgatatgtgattac
agaaacagcggtatggatgtgtgcctcgtaagctccggcgctatcgcggttggacgtgat
gtgataggcataaaggagcgcccgagcgacatttcaataaagcaggcatgcgccgcagtt
ggacagggcaggcttatgatgacatatcagaagcttttttccgagtataatcagaattcc
ggacaggtgctcatgacaaagaataccatagtcaatcctgtttcaagacgcaatgttatg
aatacatttgaggagctttttgatctgaacgtggtgcctattgtcaatgaaaatgatacg
gtaagcacatacgagatgcagtttggtgacaatgatacgctgtctgctattgttacatca
atcacgaaggccgatctgctcatactgctttctgatatagacggactgtattccgacgat
cctcatgacaatccggatgcaaagcttatcagagaggttgatacgcttgacaggaaaata
cttggcatggcaaagtcatcaaccggcagcgatgtcggaaccggcggcatggcgacaaag
cttacagcggcaaagattgccacatattccggtgccgatatgattatcgcaaacggcggc
aatatgggaattttatatgacattatgaatgacagatatacaggaacacttttccacagg
gcaaaggatgcagagtttgtgcttgcggattatatacaaagagagatggcacctacatct
acaggcggccagtaa

DBGET integrated database retrieval system