KEGG   Eubacterium rectale ATCC 33656: EUBREC_1687Help
Entry
EUBREC_1687       CDS       T00909                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00340  Histidine metabolism
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01230  Biosynthesis of amino acids
Module
ere_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    EUBREC_1687
Enzymes [BR:ere01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EUBREC_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACR75431
UniProt: C4Z9Z0
Position
1569817..1571106
Genome map
AA seq 429 aa AA seqDB search
MRTLKLTKDSQKNILESLLKRSPNNYTEYESTVNEIINNVKENRDKAVFEYTKKFDKADV
DASNIRVTEEEIKEAYELVDEKLLAVIKKALVNIRKYHEKQLQNSWFTTEDGIILGQKVT
PIAKAGVYVPGGKAVYPSSVLMNVLPAKVAGVEKIVMCTPCGADGKVYPSTLVAANEAGV
DEIYKVGGAQAIAAMAFGTESVPKVDKIVGPGNIFVALAKKAVFGYVSIDSIAGPSEILV
LADETANPRYVAADLLSQAEHDEMASAILITTSEELAKKVSEEVDKFVEVLSRKEIIEKS
LENYGYILVAEDMDEAIDAVNDIASEHMEIVTRDPFSVMTKIKNAGAIFIGEYSSEPLGD
YFAGPNHVLPTNGTAKFFSALSVDDFIKKSSIISYSREALERIHTDIEQFAECEKLTAHA
NSIKVRFED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagaactttaaaacttacaaaggattcacagaagaacatattggagagcctgcttaag
agaagccctaacaactatacagagtatgagagcacggtaaatgagattataaacaatgta
aaggaaaaccgtgataaggctgtttttgaatacacaaagaaatttgataaagcggatgtg
gatgcatcaaatatccgtgtcacagaggaagaaataaaggaagcatatgagctggttgat
gagaagcttcttgccgttataaaaaaagctcttgtaaatatcagaaaatatcatgagaag
cagctgcagaactcatggtttacaacagaggacggcatcattttaggacagaaggtcaca
cctatagcaaaggcaggagtatatgtgccgggcggcaaggctgtctatccttcatctgtg
ctgatgaacgtgcttcctgcaaaggtagcaggcgttgaaaagattgttatgtgtacacca
tgtggagctgacggcaaggtatatccttccacacttgtagccgcaaacgaggccggagta
gatgaaatctacaaggtaggtggtgcacaggctatcgctgcaatggcatttggtacagag
agtgtgccaaaggtagacaagattgttggaccgggaaatatttttgttgcccttgccaaa
aaggctgtgtttggatatgtcagcattgattcaatcgcaggacctagcgagattctggtg
cttgcagatgagactgcaaatccacgttatgtggcagcggatttactttcacaggccgag
catgatgagatggcatcagctatcttgatcacaacaagtgaggagcttgcaaagaaagta
tcagaggaagttgataagtttgttgaggtcctctcaagaaaagaaatcattgagaaatct
cttgaaaactacggatatatacttgttgcagaggatatggatgaggcaattgatgcagta
aacgatatcgcttcagagcatatggagattgtcacaagagatcctttctcagtcatgaca
aaaatcaaaaatgcaggagcaatttttatcggagagtactcatcagagcctttgggagac
tattttgcaggaccaaaccatgttctgcctacaaacggaacagcaaaattcttctcagcc
ttatctgtagatgactttatcaaaaagtcaagcatcatctcatattcaagagaagcactt
gagagaatacatacagatattgagcagtttgcagagtgtgagaagcttacggcacatgca
aattcaatcaaggttagatttgaggattag

DBGET integrated database retrieval system