KEGG   Eubacterium rectale ATCC 33656: EUBREC_1687Help
Entry
EUBREC_1687       CDS       T00909                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ere01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ere00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1569817..1571106
Genome map
AA seq 429 aa AA seqDB search
MRTLKLTKDSQKNILESLLKRSPNNYTEYESTVNEIINNVKENRDKAVFEYTKKFDKADV
DASNIRVTEEEIKEAYELVDEKLLAVIKKALVNIRKYHEKQLQNSWFTTEDGIILGQKVT
PIAKAGVYVPGGKAVYPSSVLMNVLPAKVAGVEKIVMCTPCGADGKVYPSTLVAANEAGV
DEIYKVGGAQAIAAMAFGTESVPKVDKIVGPGNIFVALAKKAVFGYVSIDSIAGPSEILV
LADETANPRYVAADLLSQAEHDEMASAILITTSEELAKKVSEEVDKFVEVLSRKEIIEKS
LENYGYILVAEDMDEAIDAVNDIASEHMEIVTRDPFSVMTKIKNAGAIFIGEYSSEPLGD
YFAGPNHVLPTNGTAKFFSALSVDDFIKKSSIISYSREALERIHTDIEQFAECEKLTAHA
NSIKVRFED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagaactttaaaacttacaaaggattcacagaagaacatattggagagcctgcttaag
agaagccctaacaactatacagagtatgagagcacggtaaatgagattataaacaatgta
aaggaaaaccgtgataaggctgtttttgaatacacaaagaaatttgataaagcggatgtg
gatgcatcaaatatccgtgtcacagaggaagaaataaaggaagcatatgagctggttgat
gagaagcttcttgccgttataaaaaaagctcttgtaaatatcagaaaatatcatgagaag
cagctgcagaactcatggtttacaacagaggacggcatcattttaggacagaaggtcaca
cctatagcaaaggcaggagtatatgtgccgggcggcaaggctgtctatccttcatctgtg
ctgatgaacgtgcttcctgcaaaggtagcaggcgttgaaaagattgttatgtgtacacca
tgtggagctgacggcaaggtatatccttccacacttgtagccgcaaacgaggccggagta
gatgaaatctacaaggtaggtggtgcacaggctatcgctgcaatggcatttggtacagag
agtgtgccaaaggtagacaagattgttggaccgggaaatatttttgttgcccttgccaaa
aaggctgtgtttggatatgtcagcattgattcaatcgcaggacctagcgagattctggtg
cttgcagatgagactgcaaatccacgttatgtggcagcggatttactttcacaggccgag
catgatgagatggcatcagctatcttgatcacaacaagtgaggagcttgcaaagaaagta
tcagaggaagttgataagtttgttgaggtcctctcaagaaaagaaatcattgagaaatct
cttgaaaactacggatatatacttgttgcagaggatatggatgaggcaattgatgcagta
aacgatatcgcttcagagcatatggagattgtcacaagagatcctttctcagtcatgaca
aaaatcaaaaatgcaggagcaatttttatcggagagtactcatcagagcctttgggagac
tattttgcaggaccaaaccatgttctgcctacaaacggaacagcaaaattcttctcagcc
ttatctgtagatgactttatcaaaaagtcaagcatcatctcatattcaagagaagcactt
gagagaatacatacagatattgagcagtttgcagagtgtgagaagcttacggcacatgca
aattcaatcaaggttagatttgaggattag

DBGET integrated database retrieval system