KEGG   Eubacterium rectale ATCC 33656: EUBREC_1840Help
Entry
EUBREC_1840       CDS       T00909                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUBREC_1840
Enzymes [BR:ere01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EUBREC_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723046..1724557)
Genome map
AA seq 503 aa AA seqDB search
MGKEARRFVDFLEKGGQTYWQILPICPTSYGDSPYQSFSSFAGNPYFIDLELLCKDKLLT
KKECESYKWGKKPQYVDYGIMYVNRYALLRKAYERFSKKTPADYEAFCSKEAEWLDEYTL
FMALKDANGGVAWSEWDDALKFRKPEAMEEAKEKYADDIAFYKMLQYLFFKQWTALKAYA
NEKGIRIIGDVPIYVAMDSADVWANPTQFYLDKDLNPIEVAGCPPDAFSADGQLWGNPLF
RWDVMKKDSYSWWTKRISAMAKLYDIVRIDHFRGFDSFYAIPAKDDTAKNGVWKDGPGMD
LFNVLEKKLGKLPIIVEDLGFLTPSVKKLLKDSGFPGMKVIQFAFDSREDSDYLPHNYPQ
HCVVYTGTHDNDTVMGWMKTAPKDCVRFAKDYLNLTKEEGYNWGMMRAAWSSVADMAIVP
MQDLLGLDSKARINIPSTTGGNWQWRATPEQIDNKLAKKLHKCMQMYARLREEPEEASDK
SDAKETADASTSKTAGCEKKAAK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaggcaagacgttttgtcgatttccttgagaagggaggtcagacatactgg
cagattcttccaatctgtcctaccagctatggagattctccataccagtcattttcaagc
tttgcaggcaatccttattttatcgatctggagcttttatgcaaggacaagcttctgaca
aagaaggagtgcgagtcatataagtggggcaaaaagccacagtatgtagactatggcatt
atgtatgtcaacagatatgctcttttaagaaaggcatatgagcgtttttcaaagaaaaca
ccggctgactatgaagcattctgcagtaaagaggcagagtggcttgatgagtacacactc
tttatggcattaaaggatgccaatggcggagtggcatggagcgagtgggatgatgctctc
aagtttagaaaacctgaggctatggaagaagcaaaggagaagtatgctgatgatattgcc
ttctacaagatgctccagtatctcttcttcaagcagtggactgctttaaaggcatatgct
aatgaaaagggcataagaattatcggagatgtacctatttatgttgccatggattcagca
gatgtatgggctaatcctacacagttctatctcgataaagacttaaatccaatcgaggtg
gcaggctgtcctcctgatgccttctcagctgacggacagctctggggcaatcctcttttc
agatgggatgttatgaagaaggacagctacagctggtggacaaagcgtatcagtgctatg
gcaaagctttatgatatcgtgcgaatcgatcatttcagaggttttgattcattctatgct
attcctgcaaaggatgatacagcaaagaacggtgtatggaaagatggacctggcatggat
ttattcaacgtgcttgagaagaagcttggtaagcttcctatcatcgtggaggacctcggc
ttcctcacaccttccgtaaagaagcttttaaaggattcaggcttccctggcatgaaggtt
atccagtttgccttcgattcaagagaagatagcgattatctgccacataactatccgcag
cactgtgttgtatacacaggtacccatgacaatgacacagttatgggctggatgaagaca
gctccaaaggattgcgtaaggtttgcaaaggattacttaaacctcacaaaggaggaaggc
tacaactggggtatgatgcgtgcggcatggtcatcagttgccgatatggctattgttcct
atgcaggatctgcttggacttgattcaaaggcccgtatcaacattccttcaactaccggt
ggcaactggcagtggagagctactcctgagcagatagacaataagcttgcaaagaagctt
cacaagtgtatgcagatgtacgcacgtctgagagaggagcctgaggaggcttctgacaaa
tcagatgctaaagaaacagctgatgcttctacaagcaagacagcaggatgtgagaaaaag
gctgctaagtag

DBGET integrated database retrieval system