KEGG   Eubacterium rectale ATCC 33656: EUBREC_2033Help
Entry
EUBREC_2033       CDS       T00909                                 

Definition
beta-galactosidase, small subunit (lactase, small subunit)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ere00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ere00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ere00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1920068..1921015)
Genome map
AA seq 315 aa AA seqDB search
MAYTDKLRVVYGDYTLGVHGEGFDYIFSYAQGGLESIVKNGYEWLYRCPKPTFWRALTDN
DRGSKFHIKSGSWLSADMFIDCKGIQVIMDGKEQNPYAPDNNSYGGDVYADEIIVKYTYE
TITTPATTVLVSYSVDASGKIRVDVHYNGVQGLPEFPVFGMRFIMPTLADKYLYKGLSGE
TYPDRKAGAQEGVYEIGDLSLTQYLVPQECGMRMDTEWLEITRHTALDNSRTDSSSQTLR
IEKNDEKFAFSCLPYTASEIENALHHEELPPARRTVLCIYGAVRGVGGIDSWGTDVEEDY
RISAETDKDYSFTIC
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcttatacagataaattaagagtggtctatggtgactatacattaggtgtacatggt
gaaggctttgattatattttctcttatgcacaggggggactggaatctatcgttaaaaat
ggatatgagtggctgtatcgttgcccaaagcctactttctggagagcgttgacagataat
gacaggggaagcaagttccatattaaaagcggaagctggctttcggcagatatgtttatt
gactgtaagggaatacaggtgatcatggatggcaaggagcaaaacccatatgcacctgat
aataacagctatggcggtgatgtttatgctgatgaaattattgtaaaatatacatacgag
accataacaactccggcgacaactgttcttgtgagctatagcgttgatgcgtccggaaag
attcgcgtggatgtacattataatggagtacaggggctccctgaatttcctgtatttgga
atgagatttattatgccaacattggctgacaaatatttatataagggactctccggggaa
acatatcctgacagaaaagcaggtgcacaagaaggcgtctatgagataggtgatctgagt
cttacacaatatcttgttccgcaggaatgtggtatgagaatggatacagagtggcttgaa
attacaagacatacggctcttgataacagcaggacagatagctcgtcacagacactgcgc
attgaaaagaatgatgaaaaatttgcattttcttgtctgccttataccgcatctgagatt
gaaaacgctcttcaccatgaagaactgccaccggcaagaagaactgttttatgcatatat
ggcgcagtaagaggtgttggaggtatcgacagctggggaactgatgtggaagaggattat
cgtatcagtgcggagactgataaggattattcttttacaatctgttag

DBGET integrated database retrieval system