KEGG   Eubacterium rectale ATCC 33656: EUBREC_2314Help
Entry
EUBREC_2314       CDS       T00909                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EUBREC_2314
   01230 Biosynthesis of amino acids
    EUBREC_2314
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBREC_2314
   00030 Pentose phosphate pathway
    EUBREC_2314
   00051 Fructose and mannose metabolism
    EUBREC_2314
   00052 Galactose metabolism
    EUBREC_2314
  Energy metabolism
   00680 Methane metabolism
    EUBREC_2314
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EUBREC_2314
Enzymes [BR:ere01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EUBREC_2314
Protein phosphatases and associated proteins [BR:ere01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUBREC_2314
Messenger RNA biogenesis [BR:ere03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EUBREC_2314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177604..2178842
Genome map
AA seq 412 aa AA seqDB search
MNQSNCIVAQSGGPTVAINASLAGVIAGVKSSEKYDICYGAVNGILGILNENYLNLSDIF
ADDANLEKLKTTPAMYLGSCRHKLPDYKDDDSPYVYIFHQFDKLSIKAFFYIGGNDSMDT
VLKLSDYAKKINSDVKIIGIPKTIDNDLCMTDHTPGFGSAAKYIASSMLEIAHDTFIYAV
KSVTIVEIMGRDAGWLTAASALARNEYNTAPQFIYLPEVNFDKDKFVADIKEALAHTNNV
IVAVSEGIHDADGSYITSSKAACDQFGHQQLSGAGKALEFIVKENIGVKVRSVEVNVLQR
CASHLASLTDIEESFAQGKKGVTIAAEGVTASMVCLKRISNKPYQVEYTYSAIKDIANEA
KSVPREWINDAGNDVKPELIEYLKPLIQGETAVAYKNGLPDYMDVSHLHKCN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtcaaactgtatcgtcgcccagtcaggcggcccaactgttgcaatcaacgca
agccttgcaggagtcatcgcaggagtaaaaagctctgagaaatacgatatctgctatggc
gccgtaaacggaatactcggcatattaaatgagaattatctcaatctgtcagatattttt
gcagatgatgctaatcttgaaaagcttaagaccacacctgccatgtatcttggctcatgc
cgccacaaactccctgattacaaggatgatgattcaccatatgtatacatcttccaccag
ttcgataagctttccataaaagctttcttttacatcggtggaaatgattcgatggatacc
gtattaaagttatccgattatgcaaaaaaaatcaacagtgatgtgaaaattatagggatt
ccaaaaaccatcgacaatgatctgtgcatgacagaccacactcctggctttggctctgcc
gccaaatatatcgcatcaagcatgcttgagatagcccatgatacctttatctatgctgtt
aagagtgtgacaatcgttgaaatcatgggacgtgacgcaggatggctcactgccgcttcc
gctctcgcacgtaatgagtacaatacagcgcctcagttcatctatctgcctgaggtgaat
ttcgacaaggacaaatttgttgccgatataaaagaagcccttgcgcacactaacaatgta
atagtcgccgtatccgaaggaatacatgacgcagacggctcatacattacatcatcaaag
gccgcatgtgaccagttcggacaccagcagctaagcggtgccggaaaagctcttgagttc
atcgtaaaggaaaacatcggtgtcaaggtgcgctctgtagaggtaaatgtgctccagcgc
tgtgcctcacatcttgcatcattaaccgatatcgaggaatcttttgctcagggtaaaaag
ggtgtcactattgcagcagagggtgtgaccgcatcaatggtatgcttaaagcgcatctca
aataagccttatcaggtggaatacacatattctgctatcaaggatatcgcaaacgaggcc
aagtctgtgccaagagagtggatcaatgatgctggcaatgatgtgaaacctgaacttatc
gaatacttaaagccacttattcagggagaaaccgctgtagcctacaagaatggtctgcct
gactatatggatgtgtcacatcttcacaaatgtaactga

DBGET integrated database retrieval system