KEGG   Eubacterium rectale ATCC 33656: EUBREC_2453Help
Entry
EUBREC_2453       CDS       T00909                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ere00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2320238..2322247
Genome map
AA seq 669 aa AA seqDB search
MQSKFKRILFGGDYNPNQWPKEVWKQDMAYFKDAHINSATINVFSWAKIQPSENEYNFTE
LDEIVDMLSNENYDIVMATSTAALPAWMVKKYPDTMSTDYEGRQHKFGARHNFCPNSLVY
QKYAKALVTELAKRYSDNKNISVWHINNEYGGYCYCDNCQKQFRVWLKDKYKTLDAVNDA
WNTEFWGHTFYDWDEIVVPNELSEEAWGGMTSFAGISTDYRRFYSDSMLNCYKLERDAVK
AIIPDALVTTNLMGTFKGLDYFKWAKEMDIVSWDNYPAYDTPWSMVAMTHDLMRGLKDEP
FMLMEQTPSQQNWQHYNSLKRPGQMRAQSYQTIAHGADTIQFFQLRRSKGGCEKFHGAVI
AHVGTNDTRVFRETALLGRELESFGTRTLGTRNKSDVGIIFDWDNYWALEYTSGPTRDLK
YVDQIHHYYEYFYNKNISVDMIPVDGDFSKYKVIAAPVLYMVKEGMKERLEQFVKNGGTL
ITTFMSGIVDQSDNVHLGGYPGPLREMAGVWVEEIDALAPEQSNTVSFSDGKEYKCNLLC
DLMHPEGAEVLATYESDFYAGMPAVTKNIYGKGHVYYVATQLEAAGLARVLDEATNEVSV
SGVIAEETGLEITCRESENTRFYFVMNFTDEKQTLPASLAGMVDLITGEAAKEGDVMNKW
DVKILQEAL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaaaattcaaaagaatcctttttggaggagattacaatccaaatcagtggcct
aaggaggtctggaagcaggacatggcatactttaaggatgcccatatcaacagtgccaca
atcaacgttttttcatgggctaaaatacagccgtctgagaatgagtataatttcacagag
cttgacgaaatagttgatatgctctcaaatgaaaactacgacatcgtcatggcaacatcc
acagcggcactgcctgcatggatggtcaaaaaatatcctgatacaatgagcaccgactac
gagggacgccagcataaatttggagccagacacaatttctgtccgaactccctggtatat
cagaagtacgcaaaggctcttgtgacagagcttgcaaaacgctatagtgacaataaaaat
atttctgtatggcacatcaataacgagtatggcggatactgttactgtgacaactgtcag
aagcagtttcgtgtatggctcaaggataagtacaagactcttgatgccgtaaatgatgcc
tggaacacagagttctggggacacaccttctatgactgggatgagatagtcgtacctaac
gagctcagcgaggaggcctggggtggcatgacaagctttgccggaatatcaacagactac
aggcggttttactctgacagcatgctgaactgctataagctggagcgcgatgcagtaaaa
gctatcattcccgatgcacttgtcacaacaaacctgatgggtaccttcaagggtcttgac
tatttcaagtgggctaaagagatggatatcgtttcgtgggataattaccctgcatacgac
acaccatggagcatggttgcgatgactcacgatttgatgcgaggtcttaaggatgagcca
ttcatgctcatggagcagactccaagccaacagaactggcagcactacaattcattgaag
cgtccgggacagatgcgtgcacagagctatcagaccatagcccacggtgcagacactatc
cagttcttccagctcagacgaagcaaaggtggctgcgagaaattccacggtgctgtaata
gcacatgtcggaacaaatgacacaagagtattcagagagactgcactgcttggaagggag
cttgaaagcttcggcacaaggacacttggcacacgcaataagtcagatgtgggaatcatc
tttgactgggacaattactgggcacttgagtacacaagcggacctaccagggaccttaaa
tatgttgaccagattcaccactattatgagtatttttacaacaaaaatatctctgtcgat
atgattccggttgatggtgatttttcaaagtataaggtgattgccgcacctgttctctac
atggtaaaggaaggcatgaaggaaaggctcgagcagtttgtgaaaaacggcggtactctc
atcacaacatttatgagtggtattgtggaccagtctgacaacgtgcatctgggcggatat
cccggacctcttcgcgagatggcaggtgtctgggttgaggaaattgatgccctcgcacct
gagcagtcaaacactgtaagcttttctgatggaaaagaatataaatgcaatctgctgtgc
gacctgatgcacccggaaggtgcagaagtactcgccacatatgaaagcgatttctatgca
ggaatgcctgctgtcacaaagaacatctacggaaaaggccatgtatactatgttgccaca
cagcttgaggcagccggacttgcaagggtgcttgatgaagccacaaatgaagtgtctgta
tcaggtgtcattgctgaagagacaggtcttgaaatcacatgccgcgagagcgaaaataca
cgcttttactttgtgatgaatttcactgatgaaaagcagactctccctgcaagccttgca
ggaatggttgacctgatcaccggagaagcagctaaagagggcgatgtgatgaataagtgg
gatgtgaagatacttcaggaagcactataa

DBGET integrated database retrieval system