KEGG   Eubacterium rectale ATCC 33656: EUBREC_2472Help
Entry
EUBREC_2472       CDS       T00909                                 

Definition
adenylylsulfate reductase subunit alpha
Orthology
K00394  
adenylylsulfate reductase, subunit A [EC:1.8.99.2]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EUBREC_2472
Enzymes [BR:ere01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With other acceptors
    1.8.99.2  adenylyl-sulfate reductase
     EUBREC_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2339573..2341279)
Genome map
AA seq 568 aa AA seqDB search
MKIENKKILHTDILIIGGGTAGCYAALTIREKSDYSIIIAEKANIKRSGCLAAGVNAINA
YIVKGRKPEDYVDYAKKDADGIVREDLLMTMSEGLNRVTDKMEKLGLVILKDENGEYVAR
GNRNIKINGENMKPILAEAVSKITDCTVINRINITDYIVENNTIKGAYGFSIEDATAYEI
RAKKVLCATGGAAGLYRPNNPGFSRHKMWYPPFNTGAGYAMGIRSGAEMTTFEMRFIALR
CKDTIAPTGTIAQGVGAKQVNSLGEVYETKYGLTTSERVYGTVMENLEGRGPCYLRTEGI
SPQQDESLRKAYLNMAPSQTLKWVEAGKNPSEQNVEIEGTEPYIVGGHTASGYWVNTERE
TTIHGLYAAGDVAGGCPQKYVTGAMVEGEIAAIDMVSKLDADTSDGSPDTSAFDEKKALE
AKASEYDHFLTERFKMFTTEAIEEAMQKVMDNYAGGISTHYQFNGKQLALAKEKINHLIE
LTGDLYASDMHELMFIYELKERLTVCLSVIAHLGARKETRWHSFAENLDYPDKSDDWMKY
VNSKYENGQLHMIYRELVGREARYEHND
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaaaacaaaaaaatcctacacacggacatcctcataataggaggtggcacg
gctggctgttatgcagcgctcaccatccgtgagaaatcggattattcgattataattgca
gagaaagcgaacataaagcgaagcggatgccttgcagcaggtgtcaatgcgataaatgca
tacatagtaaagggcagaaagcctgaggactatgtagactacgcaaaaaaggatgctgac
ggcatagtaagggaagacttactcatgactatgtccgagggcttaaaccgtgtgacggac
aagatggaaaagcttggacttgtcatattaaaggatgaaaacggtgagtatgtagcaaga
ggaaaccgaaatatcaaaataaatggcgagaacatgaagccgattttggcagaagctgta
tcaaagattacggactgtacagtgataaacagaatcaatatcacggactatatagttgag
aacaacaccataaagggtgcatacggattttcaatcgaggatgctacagcctatgaaatc
agggctaaaaaggtgctctgtgcaacaggcggagcggccggtttatacaggccaaacaat
ccgggattttcaaggcacaagatgtggtatccgccatttaatacaggcgccggatatgcg
atgggcataagaagcggagcagagatgaccacctttgagatgagatttatcgcactcaga
tgcaaggacacaatcgcaccgacaggaacaattgcacagggagtcggggcaaagcaggtc
aattcacttggagaggtttacgagacaaaatacggccttaccacatcagagcgtgtatac
ggaacggtcatggaaaatctcgagggaagaggtccttgctacttaaggacagagggcatt
tcgccacagcaggatgagtcattaagaaaggcatatctcaacatggcaccaagccagaca
ctcaagtgggtggaggcaggtaagaatccaagtgagcagaatgtggagatagagggcact
gagccgtatatcgtaggtggccacacagcgagcggctactgggtaaataccgagcgtgag
actacaatccacggactttatgctgctggagatgtggcaggaggatgtccacagaaatat
gttacaggagctatggtagagggcgaaatcgctgcgatagatatggtttcaaagctagat
gcagatacctccgacggaagtcctgacacatcggcatttgatgagaaaaaggcgcttgaa
gcaaaagcttcagagtacgaccatttcctcactgaaaggttcaagatgtttacaacagag
gctatcgaggaagccatgcagaaggtcatggacaactacgcaggcggtatttccacacat
tatcagttcaacggcaagcagcttgcgctggcaaaggaaaagataaatcatctgatagag
ctgaccggtgatttatatgcatcggatatgcatgagcttatgttcatatatgagcttaag
gagaggcttacggtatgtctttcggttatagcacatcttggtgcaagaaaggagaccaga
tggcacagctttgccgagaatctggattatcctgacaagagtgatgactggatgaaatat
gtcaattccaaatacgaaaacgggcagcttcacatgatttacagagagcttgtcggaagg
gaggcgcgttatgagcataatgattga

DBGET integrated database retrieval system