KEGG   Eubacterium rectale ATCC 33656: EUBREC_2800Help
Entry
EUBREC_2800       CDS       T00909                                 

Definition
lysophospholipase L2 PLDB, hydrolase of alpha/beta superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ere00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2676959..2677906)
Genome map
AA seq 315 aa AA seqDB search
MIITEEKYNEELTRYVLPFIRLNFEDGYMKSADGTRIHYGYVTTPVAKAAIVISHGFTEC
MPKYYEMIYYFAKAGYSVYMVEHRGHGFSDRSVSDISMVTVNSFDDYVSDLDMFIREIVM
KREGRRPLYLYGHSMGGAIAALYLEKHPEVFTKAVLSSPMIEMLYGNFSHFAVEAILFVA
SVLNWNDKYLPSQTPYTDEYDFESSCCLSKARYDYIYKCKVEEERYRTNGATYRWCRAGR
KASKYIKKHAQEIKIPVLLCQAGKDYLVSNAAEDEFIAKLPQGIKKVYPDSKHEIFNADD
DTLEKFYSDILDFWA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattattacagaagaaaaatataatgaggaattaacaagatatgttttgccttttatc
aggcttaattttgaagatggctatatgaagagtgcagatggcacacgcatacattacggc
tatgtgacgacacctgtagcaaaggctgccatagtcatatcacatggatttacagagtgt
atgcctaaatattatgagatgatttactatttcgcaaaggccggatactcagtatatatg
gtggagcatcgaggacacggcttttcggacagaagtgtatccgatataagcatggtcact
gtaaacagctttgacgattatgtgagtgaccttgatatgtttatccgcgagattgtgatg
aagcgtgaggggcgcagaccgctttacttgtacggtcactctatgggaggcgcgatagct
gccctgtatcttgagaagcatcctgaggtatttacaaaggcagtactttcaagccctatg
atagagatgctttatggcaatttttcacattttgccgtggaggcgatactgtttgtcgca
agtgtgcttaactggaacgataaatatctgccgagccagacaccgtatacggatgagtat
gattttgaatcgagctgttgtctgtcaaaggcgcgctatgactacatatacaagtgcaag
gtggaggaggaacgctatcgtacaaatggcgccacctacagatggtgcagggccgggcgc
aaggcatccaaatatataaagaagcatgcacaggaaattaaaataccggtgctgttatgc
caggcgggaaaggattatctggtttcaaatgccgctgaggatgaatttattgcgaaactg
cctcagggcattaagaaggtctatcctgattcaaagcacgagatatttaatgcggatgat
gataccttggagaagttttactcagatatccttgatttttgggcttga

DBGET integrated database retrieval system