KEGG   Eubacterium rectale ATCC 33656: EUBREC_2800Help
Entry
EUBREC_2800       CDS       T00909                                 

Definition
(GenBank) lysophospholipase L2 PLDB, hydrolase of alpha/beta superfamily
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EUBREC_2800
Enzymes [BR:ere01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EUBREC_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Peptidase_S28 LIDHydrolase Esterase Abhydrolase_5 DLH PGAP1 Thioesterase Lipase_3 Peptidase_S15 LCAT Abhydrolase_8
Motif
Other DBs
NCBI-ProteinID: ACR76530
UniProt: C4ZHP3
Position
complement(2676959..2677906)
Genome map
AA seq 315 aa AA seqDB search
MIITEEKYNEELTRYVLPFIRLNFEDGYMKSADGTRIHYGYVTTPVAKAAIVISHGFTEC
MPKYYEMIYYFAKAGYSVYMVEHRGHGFSDRSVSDISMVTVNSFDDYVSDLDMFIREIVM
KREGRRPLYLYGHSMGGAIAALYLEKHPEVFTKAVLSSPMIEMLYGNFSHFAVEAILFVA
SVLNWNDKYLPSQTPYTDEYDFESSCCLSKARYDYIYKCKVEEERYRTNGATYRWCRAGR
KASKYIKKHAQEIKIPVLLCQAGKDYLVSNAAEDEFIAKLPQGIKKVYPDSKHEIFNADD
DTLEKFYSDILDFWA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattattacagaagaaaaatataatgaggaattaacaagatatgttttgccttttatc
aggcttaattttgaagatggctatatgaagagtgcagatggcacacgcatacattacggc
tatgtgacgacacctgtagcaaaggctgccatagtcatatcacatggatttacagagtgt
atgcctaaatattatgagatgatttactatttcgcaaaggccggatactcagtatatatg
gtggagcatcgaggacacggcttttcggacagaagtgtatccgatataagcatggtcact
gtaaacagctttgacgattatgtgagtgaccttgatatgtttatccgcgagattgtgatg
aagcgtgaggggcgcagaccgctttacttgtacggtcactctatgggaggcgcgatagct
gccctgtatcttgagaagcatcctgaggtatttacaaaggcagtactttcaagccctatg
atagagatgctttatggcaatttttcacattttgccgtggaggcgatactgtttgtcgca
agtgtgcttaactggaacgataaatatctgccgagccagacaccgtatacggatgagtat
gattttgaatcgagctgttgtctgtcaaaggcgcgctatgactacatatacaagtgcaag
gtggaggaggaacgctatcgtacaaatggcgccacctacagatggtgcagggccgggcgc
aaggcatccaaatatataaagaagcatgcacaggaaattaaaataccggtgctgttatgc
caggcgggaaaggattatctggtttcaaatgccgctgaggatgaatttattgcgaaactg
cctcagggcattaagaaggtctatcctgattcaaagcacgagatatttaatgcggatgat
gataccttggagaagttttactcagatatccttgatttttgggcttga

DBGET integrated database retrieval system