KEGG   Eubacterium rectale ATCC 33656: EUBREC_2976Help
Entry
EUBREC_2976       CDS       T00909                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUBREC_2976
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBREC_2976
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EUBREC_2976
Enzymes [BR:ere01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EUBREC_2976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2858843..2860033)
Genome map
AA seq 396 aa AA seqDB search
MTNPNGRFGIHGGQYIPETLMNAVKELEEAYNYYKNDPEFNRELTELLNDYAGRPSRLYY
AEKMTKDLGGAKIYLKREDLNHTGAHKINNVLGQALLAKKMGKTRLIAETGAGQHGVATA
TAAALMGMECVVFMGEEDTKRQALNVYRMRLLGAEVIPVTSGTATLKDAVSEAMREWTKR
ISDTHYCLGSVMGPHPFPTIVRDFQAVISKEIKEQMLEKEHRLPDAVIACVGGGSNAIGS
FYNFIEDEGVELIGCEAAGRGIDTFETAATVNTGRLGIFHGMKSYFCQDKYGQIAPVYSI
SAGLDYPGVGPEHAYLHDIGRAKYVPVTDDEAVNAFEYLAKTEGIIPAIESSHAVAYAMK
LAPTMDKDKIIVVTVSGRGDKDCAAIARYRGENIYE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatccaaacggaagatttggtattcacggaggacagtacattcctgaaaccctc
atgaatgccgttaaagaattagaagaagcatacaattattacaaaaacgatcctgaattt
aacagagagctcacagagcttctcaacgattatgcaggaagaccatcgagactgtactac
gcagaaaagatgacaaaggatctcggtggagcaaaaatataccttaaaagagaggattta
aaccatacaggagcccacaagatcaacaacgtattaggtcaggcacttcttgcaaagaaa
atgggcaaaacccgcctgatagctgagaccggagccggtcagcacggtgtggcaacagca
acggccgcagcccttatgggtatggaatgcgttgtattcatgggcgaggaggacacaaag
cgtcaggcgctcaatgtataccgcatgcgtctgctcggagcagaggttatcccggttaca
tcaggtacagccacattaaaggatgccgtatcggaggcaatgagagagtggaccaagaga
atttcggacacacattactgcctgggctcagttatgggaccacatccgttccctaccatc
gtaagagatttccaggcggtcatctcaaaggaaatcaaggagcagatgcttgaaaaggag
cacagactgcctgatgcggttatcgcatgtgtgggcggcggctcaaatgccattggaagc
ttttacaacttcatagaggatgagggagttgagctcatcggctgcgaggcagcaggaagg
ggaatagatacatttgagactgcagccacagtaaatacaggccgtcttggtatcttccac
ggcatgaagtcatatttctgtcaggataaatatggacagattgctccggtttattcaatt
tctgcaggacttgactatccgggagtcggaccggagcacgcatatctgcacgatatcgga
agagcaaaatatgtaccggtaacagatgatgaagcggtaaatgcttttgaatacctcgca
aagacagagggaatcatccctgcaatcgagtcctcacatgcagtggcatatgccatgaag
ctggcgcctacaatggacaaggacaagataatcgttgttactgtttcaggcagaggcgac
aaggactgcgcggcaatagcaagatacagaggggagaatatttatgaataa

DBGET integrated database retrieval system