KEGG   Eubacterium rectale ATCC 33656: EUBREC_2977Help
Entry
EUBREC_2977       CDS       T00909                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase, TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01130  Biosynthesis of antibiotics
ere01230  Biosynthesis of amino acids
Module
ere_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EUBREC_2977
Enzymes [BR:ere01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EUBREC_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth ThiG PDZ FMN_dh Dioxygenase_N
Motif
Other DBs
NCBI-ProteinID: ACR76705
UniProt: C4ZI68
Position
complement(2860132..2860920)
Genome map
AA seq 262 aa AA seqDB search
MNILDQLAEYSRLRVAEDKKKISLEEMKNIAIQMKNEKLCDFAFEKTLKKDGLSFICECK
KASPSKGLIEPDFRYLEIAREYEAAGADCISVLTEPKWFLGSDEYLKEIAKTVSIPCIRK
DFTVNEYQIYQAKTLGAAAVLLICSILSEEQLGEYIKICDSLGISALVEIHDEKEAGMAV
RAGARIIGVNNRNLKDFTVDTANSRKLRDLIPDDIIFVSESGVKSTDDIRAIREIGADAV
LIGETLMRADDKKAKLDELRLS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttagatcagctagcagaatattcaaggcttcgcgtggcagaggacaagaaa
aaaataagccttgaggaaatgaaaaatatcgcgattcagatgaaaaacgaaaagctttgt
gattttgcatttgaaaaaacactcaaaaaggatggcttgagcttcatatgcgagtgcaag
aaggcttcaccgtcaaaggggcttatagagccggatttcagatatcttgaaattgcaagg
gaatacgaggcggcaggtgcggattgcatctcggtactgacagagccgaagtggttttta
ggctcggatgagtatcttaaggagattgcaaaaacggtttcgattccgtgcatccgaaaa
gattttacggttaatgaatatcagatatatcaggcaaagacactcggtgccgctgcggtg
cttttaatctgctccatactgtcagaggaacagcttggtgaatatataaaaatctgtgac
agtcttggcataagcgcccttgtggagatacacgatgaaaaagaggcagggatggcggta
agagccggtgccagaataataggtgtcaacaaccgcaatctgaaggattttacagttgat
acagctaacagcagaaagcttcgtgacctgattcccgatgacatcatatttgtatcggaa
agcggtgtaaagagcacagacgatatcagggcaatacgtgaaatcggagctgacgcagtg
cttatcggagagacgctgatgagagcggacgacaaaaaggctaagcttgatgaattgcga
ttaagctaa

DBGET integrated database retrieval system