KEGG   Eubacterium rectale ATCC 33656: EUBREC_3387Help
Entry
EUBREC_3387       CDS       T00909                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EUBREC_3387
  Lipid metabolism
   00561 Glycerolipid metabolism
    EUBREC_3387
   00600 Sphingolipid metabolism
    EUBREC_3387
Enzymes [BR:ere01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     EUBREC_3387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3198912..3201098)
Genome map
AA seq 728 aa AA seqDB search
MSVIYNETRRIFKLDTENTSYLIGISPEGYVGHVYYGEYLEDADAYYLLRTEEPPFTPSV
NEREKSSFLDFFPTEYPSGGVGDYRESCINVRNEAGCMGSEFFYDSYEIKTGKPSLDGLP
ASFGGAEDVTTLEITCVDPVLNLKLILSYSAFEKEDVITRSVKIVNTGKQQVRLEKVYSA
CLDMDNENFELLTLHGSWGRERHIQRRVICYGKQLVSSAKGKPGHQEHPFIALVTPGTNQ
QQGRVYGMHFVYSGNFIGQAELTQFDTVRMVMGIHQEEFCWNLRGGESFQAPEVVLTFSE
EGLGKMTRSLHDFYRQHMIRSKYKDQKRPILINNWEATYFDFNTEKLLDIAREAKKDGIE
MLVMDDGWFGKRNSDNCSLGDWFVNEDKINGGLKHLVEEVKKIGLKFGIWFEPEMISPDS
ELYKVHPEWAIHIEGRKATQIRQQYVLDLSNPEVIDYAYESVAKILRSVSIDYVKWDMNR
ELSDLGSSYLDKDSQQELFHRYVLGLYKMQERLITEFPDLLLENCSGGGARFDPGMLYYS
PQIWCSDDTDAVERLEIQEGTALIYPLSTMGAHVSVCPNHSVGRITPFETRGHVALAGTF
GYELDITKLPEEERKMIKEQTEMYHKYNDLVREGDYYRIASFSENGHYDCYMEVAKDKSE
ALVTYVQVRGMTNNKSRKLKLQGLDPKAIYQLEGTEESYSGEILMKGGYLFKDFWGDAVS
RLYHFMKK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttatatataatgaaacaagaagaatctttaagctggatacagaaaatacatca
tacttgatcggtatttcaccggaaggatatgttgggcatgtatattatggagaatattta
gaggatgcagatgcgtactatttgttaagaacagaagaacctccgtttacaccatctgta
aatgaacgtgaaaaatcttcatttttagatttctttccgacagaatatccgtccggagga
gtgggagattatagagaaagctgcattaatgtcagaaatgaagcaggatgtatgggaagt
gagttcttctacgattcttatgaaattaagacggggaaaccatcattggatgggcttccg
gcatcttttggaggagcagaggacgtcactacacttgagattacctgtgttgatccggtc
ttaaatctgaaattaatactttcctattcagcatttgaaaaggaagatgtaataacaaga
agcgtgaaaatagtaaatacaggaaaacagcaggtaagacttgagaaagtttacagtgca
tgtctggatatggataatgagaattttgaactgctcacacttcatggctcctggggcaga
gagcgtcatatccagcgtcgggtaatttgttatggaaagcagcttgtatcatctgcaaaa
ggaaaacccggacatcaggaacatccatttatagcacttgtgacgccgggaacaaaccag
cagcagggaagagtgtatggaatgcatttcgtatactctggtaacttcatcggacaggca
gaactgacacagtttgatactgtccgtatggtaatgggaatccatcaggaagaattctgc
tggaatttacgaggtggtgaatcatttcaggctccggaggttgtgctgacattttcggaa
gaaggacttgggaagatgacaagatctcttcatgatttctatcgtcagcatatgatcaga
agtaaatacaaagatcagaagcgtccgattttgatcaataactgggaagcaacgtacttt
gattttaatacagagaaacttctggatattgcaagagaagcgaaaaaagacggcattgag
atgcttgttatggatgatggctggtttggtaagagaaattcggataactgttcacttgga
gactggtttgtaaatgaagataagattaatggcggacttaagcatcttgtagaagaagtg
aagaaaataggactgaaatttggcatctggtttgagccggagatgatttcaccggattct
gaactttataaagtacatccggagtgggcaattcatattgagggacgtaaagcaacacag
atccgtcagcaatatgtacttgatctttctaatccggaggttatagattatgcatatgaa
tctgtggcaaagattttaagaagtgtgtcgattgactatgtgaaatgggatatgaaccgg
gagttaagtgatcttggcagcagttatcttgacaaagattcgcagcaggaattattccat
cgttatgtgcttggtctatataaaatgcaggaacgtttgattacggaattccctgatttg
ttactggaaaactgctccggaggcggtgcaagatttgacccgggaatgttatattatagt
ccacagatctggtgctcagatgatacggatgcagtagagcgtctggagattcaagaggga
actgcacttatctatccgctgtctacaatgggagcgcatgttagtgtgtgtccgaatcat
tccgtaggacgaataacaccattcgaaacaagaggacatgttgcacttgcaggaacattc
ggttatgaactggatattacaaagcttccggaagaggagcgtaaaatgatcaaagaacag
acagaaatgtatcataagtacaatgaccttgtaagagagggggattattacagaatcgct
tccttctctgaaaatggtcattatgattgctacatggaagtcgcgaaggataaatctgaa
gcacttgtaacttatgtccaggtacgcggtatgacgaataataagagtagaaagttaaag
ctgcagggattagatccaaaagcaatctatcaattagaaggaacagaagagagctattca
ggagaaattctgatgaaaggcggatatctgtttaaagacttctggggagatgcggtcagc
agactgtaccattttatgaaaaaataa

DBGET integrated database retrieval system