KEGG   Eubacterium rectale ATCC 33656: EUBREC_3687Help
Entry
EUBREC_3687       CDS       T00909                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ere00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3428107..3429537)
Genome map
AA seq 476 aa AA seqDB search
MGFRKDFLWGGAVAAHQLEGAYDRDGKGLSIMDVVTGGDVNTRRRITGEILKGENYPNHE
AIDFYDYYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDEEQPNEAGLKFYDDMFDECLKYG
IEPVITLSHFEMPLHLVQEYGGWRNRKLIDFFVKFAVTCFERYKDKVKYWMTFNEINNQA
DIGDGFMLYANSGIIIKPEENAEELMYQASHYELVASAEAIKAGHEINPKFQIGCMIAMC
PIYPATCRPEDILQAEKAMQKRYYYTDVHVKGEYPVNILKYWERKDLKIDVTEEDLAVLK
QGCVDYIGFSYYMSFCTKAEPDNPEYDYRGEKDRIKNQYVKASEWGWQIDPIGLRYSLNW
FTDRYKVPLFIVENGFGAYDTLEEDGSIHDPYRVEYLQHHISEMKKAVEEDGVDLMGYTP
WGCIDLVSAGTGEMDKRYGFIYVDKHNDGTGDLSRRKKDSFEWYKEVISTNGENIN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggatttcgaaaagattttctctggggtggcgcagttgctgcccatcagctggagggt
gcctatgatcgagatggaaaaggcttgagcattatggacgttgtaaccggcggagatgta
aatacaagaagaagaataacaggtgaaatactaaaaggcgagaattatccgaatcatgaa
gcaatcgatttttatgattactataaagaagatatccgcttatttgcggaaatgggattc
aagtgtttccgtacaagtatcgcatggacacgtatcttcccaaatggtgatgaagaacag
ccgaatgaagccggattaaaattctatgatgacatgtttgatgaatgtctgaaatatggg
atcgaaccagtgatcacactgagtcattttgagatgcctctgcatcttgtacaagagtac
ggtggatggagaaacagaaaactgattgatttcttcgtgaaatttgcagtaacatgcttt
gagcgatacaaagacaaagtaaaatattggatgacatttaatgagattaacaaccaggca
gatatcggtgatggatttatgctttatgctaattccgggattataattaaaccagaagaa
aatgcggaagaattgatgtatcaggcatctcactatgaactggttgccagtgccgaagcg
ataaaagctggacatgagattaatccgaaatttcagattggctgcatgatcgcaatgtgc
ccaatctatccggctacctgccgtccggaagatatactgcaggctgaaaaagccatgcag
aaaagatattattatacagatgtgcatgtaaaaggagaataccctgtaaatattttgaaa
tactgggaaagaaaagaccttaagattgacgtaacagaagaagatcttgcagtgttaaaa
cagggctgtgtcgattacatcggtttcagttattatatgtctttctgtacaaaagcagaa
ccagacaatccggaatatgattaccgtggagaaaaggatcgcataaagaatcagtacgta
aaggcaagtgaatggggatggcagattgatccgatcggactgcgctattcattgaactgg
tttacagatcgctacaaagtaccattgtttattgtagaaaatggatttggagcatatgat
acgttagaagaggatggaagcatccacgatccataccgtgtggaatatctgcagcaccac
atttcagaaatgaaaaaggcggtagaggaagatggtgtagatctgatgggttatacacca
tggggatgcatcgaccttgtcagtgcaggaaccggtgagatggataagagatatggattc
atctatgtggataaacataacgatggaacaggagacttgtccagaagaaagaaagattct
ttcgagtggtataaagaagttatttcaacaaacggcgaaaatatcaattag

DBGET integrated database retrieval system