KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_00870Help
Entry
ERGA_CDS_00870    CDS       T00232                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
erg00300  Lysine biosynthesis
erg01100  Metabolic pathways
erg01120  Microbial metabolism in diverse environments
erg01230  Biosynthesis of amino acids
Module
erg_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ERGA_CDS_00870 (dapE)
Enzymes [BR:erg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ERGA_CDS_00870 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAI27539
UniProt: Q5FFA0
Position
complement(142263..143414)
Genome map
AA seq 383 aa AA seqDB search
MVIDPVTLSQELISFPSITPTDNGAISFLSDILSQYGFTCHILDFGDDTVTVRNLYAYRG
TEEGPNLCFAGHTDVVKTGDLTKWKFDPFSGHIEDDILYGRGAVDMKSAICAFIAAVSRI
NFNEVPGSISFLISGDEEGDHFQYGTPSVLKWLNENNHKIDYCIIGEPTSKSFLGDTIKV
GRRGSVHFKIICNGIQGHVAYPHFAENPIDNMVSILYKICNTTFDTGNEYFQPSNCEIVS
VDTGNTSRNVIPDTIVAHINIRYNNIHTAESLFDIINNICAQVTPKYQLLHSVSGEPFFN
QPNQYSDMLSSAIKKVTGQDAIASTSGGVSDSRFIKNVCPVIEFGLKNETAHKIDEHVPV
KEIYQLADIYTEFIKQFFNLSTT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggttattgatccagttacattatcacaagaattaatatcattccctagtattacacca
acagataatggtgcaataagttttctatcagatatattatcacaatatggttttacatgt
catattctagattttggtgatgatacggttacagtacgtaacttgtacgcataccgagga
acagaagaaggtccaaacctatgttttgctggacatacagatgtagtaaaaactggggat
ttaacaaaatggaaatttgatcctttttctggtcatatagaagatgatatcttatatggc
cgtggtgctgttgatatgaaatcagcaatatgtgcatttatagcagcagtatctaggata
aacttcaatgaagttccaggttccattagtttcctaatttctggagatgaagaaggagac
cattttcaatatggtacaccatcagtattaaaatggttaaatgaaaataatcataaaata
gattactgtataattggagagccaactagcaagtcgttccttggagacacaataaaagta
ggccgtagaggttctgtacattttaaaataatatgcaatggcatacaagggcatgttgca
tatccacattttgcagaaaatccaatagataatatggtgagcattctttataaaatatgt
aatacaacatttgatactggaaatgagtattttcaaccatcaaattgtgaaattgtatca
gttgacactggaaatacatcaagaaatgtaattccagatacaatagttgcacacatcaat
atcaggtataataatatacataccgctgaatcactatttgacattattaataatatttgt
gctcaagtaacaccaaaatatcaattactacattcagtaagtggtgaaccattttttaat
cagcctaatcaatattctgatatgttatcttcagctataaaaaaagtaacaggacaagat
gcaatagcaagtacatctggtggtgtttcagattcaagatttataaaaaatgtttgtcct
gtaattgaatttggcttaaaaaatgaaacagcacataaaattgacgagcatgtgcctgta
aaagaaatttatcagttagctgatatatatacagaattcattaagcaattctttaattta
tcaacaacataa

DBGET integrated database retrieval system