KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_01440Help
Entry
ERGA_CDS_01440    CDS       T00232                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
erg00020  Citrate cycle (TCA cycle)
erg00640  Propanoate metabolism
erg01100  Metabolic pathways
erg01110  Biosynthesis of secondary metabolites
erg01120  Microbial metabolism in diverse environments
erg01130  Biosynthesis of antibiotics
erg01200  Carbon metabolism
Module
erg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ERGA_CDS_01440 (sucC)
   00640 Propanoate metabolism
    ERGA_CDS_01440 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ERGA_CDS_01440 (sucC)
Enzymes [BR:erg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ERGA_CDS_01440 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: CAI27596
UniProt: Q5FH54
Position
complement(240366..241526)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKQILKRFGISVPEGVIVHSLNEVNDAINKINSKVIVVKAQIHAGGRGKAGGV
IVSRTLDEAKTAIKNMLGSTLVTHQTSKDGQKVRKVYLEEGCDIKKEYYISAIVNRKHGQ
ISIIFSTEGGVDIEEVAANSPEKVVTCNIDPIFGFQGFHGRNLCFDSNLSVDQTRKITSI
AKKIYKTMLETDASQIEINPLIETSSGDFIALDAKMNFDDNAIYRHPEILELRDYDEEIP
EEIEASKHGLSYIKMDGNIGCMVNGAGLAMATMDIIKYYGAEPANFLDVGGGASQQTVTE
AFKIILSDNVDGILVNIFGGIMRCDIIANGIIAAIQEIGINVPLVVRLSGTNFELGKKLL
DNSKLNIITAHDLSEAAYDIVNIVKK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaacaaatattaaaaaggtttggtataagtgttcca
gaaggagttatagtacactcattaaatgaagttaatgatgcaataaataagatcaactca
aaggttattgtagtcaaagcacaaatccatgcaggaggtagaggaaaagcaggaggagtt
atagtttcacgtacattagatgaagcaaaaactgcaataaaaaatatgttggggtcaact
ctagtcacacatcaaacctcaaaagatggacaaaaagtaagaaaagtatatttagaagaa
ggatgtgatataaaaaaagaatattacatcagtgctattgttaaccgtaaacatgggcaa
attagtattatattttcaacagaaggtggtgttgatatagaagaagtagctgcaaactct
ccagaaaaggttgttacatgtaatattgatccaatatttgggtttcaaggatttcatgga
cgtaatttatgttttgatagcaatttaagtgtagatcagacacgtaaaattacttctata
gctaaaaaaatatacaaaacaatgctggaaacagatgcaagtcaaatagaaattaatcca
ttaatagaaacatcatctggagattttattgcactcgatgcaaagatgaattttgatgat
aatgcaatatatcgtcatcctgaaattttagagttgcgagattatgatgaagaaattcca
gaagaaatagaagcttcaaaacatggcttaagttatattaagatggatggtaatattgga
tgtatggttaatggagcaggacttgctatggctaccatggacattatcaaatattatgga
gctgaacctgcaaattttctagatgtaggtggtggagcaagtcaacaaaccgtaactgaa
gcatttaaaattatcttatcagacaatgttgatgggatattagttaatatatttggtgga
ataatgcgttgtgatataattgctaatggtattattgctgccatacaagaaataggtatt
aacgttccacttgttgtaaggttatcaggaacaaactttgagcttggtaaaaaattactt
gataattccaagttaaatatcataacagcacatgatttaagtgaagcagcatatgatata
gttaatatagttaagaaatag

DBGET integrated database retrieval system