KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_01850Help
Entry
ERGA_CDS_01850    CDS       T00232                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERGA_CDS_01850 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ERGA_CDS_01850 (sdhD)
   00650 Butanoate metabolism
    ERGA_CDS_01850 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ERGA_CDS_01850 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305827..306177
Genome map
AA seq 116 aa AA seqDB search
MGSSVYHWLSQRVTAFIVLPFSVWFFYKFLRFLSIVCRSVSELDLSFVELNTIDVIASVC
FFIIAFYHAVLGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLVFAIFNISLNF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagctcagtttatcattggttatctcaaagagttacagcatttattgtgttacct
ttttctgtatggtttttttataaatttttacgttttctttctatagtgtgtagatctgtt
tcagaacttgatttaagttttgtggaactaaatactattgatgtaattgcgtcagtatgt
ttttttattattgctttttatcatgcagttttagggttacaagttatattagaagattat
gtccaatcttctgtattaagagtatctattcttttattaataaaagggattgtaactgta
actttgttatttttagtttttgctatatttaatatctcgttaaatttctag

DBGET integrated database retrieval system