KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_01850Help
Entry
ERGA_CDS_01850    CDS       T00232                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
erg00020  Citrate cycle (TCA cycle)
erg00190  Oxidative phosphorylation
erg00650  Butanoate metabolism
erg01100  Metabolic pathways
erg01110  Biosynthesis of secondary metabolites
erg01120  Microbial metabolism in diverse environments
erg01130  Biosynthesis of antibiotics
erg01200  Carbon metabolism
Module
erg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
erg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ERGA_CDS_01850 (sdhD)
   00650 Butanoate metabolism
    ERGA_CDS_01850 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ERGA_CDS_01850 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Spore_permease
Motif
Other DBs
NCBI-ProteinID: CAI27637
UniProt: Q5FH75
Position
305827..306177
Genome map
AA seq 116 aa AA seqDB search
MGSSVYHWLSQRVTAFIVLPFSVWFFYKFLRFLSIVCRSVSELDLSFVELNTIDVIASVC
FFIIAFYHAVLGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLVFAIFNISLNF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagctcagtttatcattggttatctcaaagagttacagcatttattgtgttacct
ttttctgtatggtttttttataaatttttacgttttctttctatagtgtgtagatctgtt
tcagaacttgatttaagttttgtggaactaaatactattgatgtaattgcgtcagtatgt
ttttttattattgctttttatcatgcagttttagggttacaagttatattagaagattat
gtccaatcttctgtattaagagtatctattcttttattaataaaagggattgtaactgta
actttgttatttttagtttttgctatatttaatatctcgttaaatttctag

DBGET integrated database retrieval system