KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_02560Help
Entry
ERGA_CDS_02560    CDS       T00232                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ERGA_CDS_02560 (recR)
DNA repair and recombination proteins [BR:erg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ERGA_CDS_02560 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420057..420644
Genome map
AA seq 195 aa AA seqDB search
MDINKLINMFAKLPNLGSSSSRRIVLYLLRNREEIMLPLASSIQELALKTKECSICFNID
VKSPCSICSDVKRDQKLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNF
NNIIARIQNSGVQEVIIGISNTMDGQVTTHYITQMIKKLGVKVTRLACGIPMGGEIDYLD
EGTLSAALSSRYVIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatattaataaattaattaatatgtttgcaaaattaccaaatttagggtcatcttct
tctaggaggatagtactttatttacttcgtaatagagaagaaataatgttacctttagca
tcaagtattcaagagttggcgcttaaaaccaaggagtgttctatatgttttaatatagat
gtaaagtctccatgtagtatttgttctgatgttaagcgtgatcagaaattattatgtata
gttgaagaattaggagatttatgggcctttgaaaagggcaaaatatatcaaggagtatat
catgttctaggaggtactttatctgctatttatggaataggtccagatcaattgaacttt
aataatattattgcaaggatacaaaactctggagttcaggaagtgataataggtattagt
aatactatggatgggcaagttactacacattatataacacaaatgataaaaaaattagga
gttaaagttactaggttagcatgtggtattcctatgggtggagaaatagattatttagat
gaaggtacattaagtgctgcattatcttctaggtatgttatttcttag

DBGET integrated database retrieval system