KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_02850Help
Entry
ERGA_CDS_02850    CDS       T00232                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ERGA_CDS_02850
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ERGA_CDS_02850
Enzymes [BR:erg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     ERGA_CDS_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479193..480578
Genome map
AA seq 461 aa AA seqDB search
MMDSSLPTIRKNKTLDSVFRVMGGMAEAIFSWVGSINKDLTRDQDIKNLYEKMKECLNPK
GGEIKARYNTISLGNLYLNLSDIGKTTFFRLLEEQFSADRNEIDEKIRDYIREIDEYEKR
KLEFELMGVLESPRFCILKQFISLPDGLKFLVDMRADVMQLRDKNQQFFSLEKDLRNILS
YWFDIGLLDLHQITWDSPASLLEKLILYEAVHAISSWDDLRDRLDSDRRCFSFFHYKMLN
DPLIFVEVALVDEMASSIQTLLDSHVPPKDPKDAKVAIFYSISNTQRGLSGISLGNFLIK
RVVGKLSEEFQNIKTYATLSPIPGFVKWLTKSLSMDNIGFLNELKITMSVDEIIFHLNEK
NYSSFSQDLKGLFLKLCAYYLVESKNNDKALDPVAHFHLSNGAIIKKLNWMADTSEKGLN
CSMGIMVNYHYELSRIDDNYEDYLVNRKINYSKEVLSLLKR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgatggatagttcattaccgacaataagaaaaaataagacactagatagtgtattcaga
gttatgggtggaatggctgaagctatattttcttgggttgggagtatcaataaagattta
acaagggatcaggatatcaaaaacctttatgaaaaaatgaaagaatgtcttaatccaaaa
ggtggggaaatcaaggcaagatataatactatatctctcggtaatttgtaccttaattta
tctgatataggtaaaacaacgtttttcaggttattagaggagcagtttagtgctgataga
aatgagatagatgagaaaataagggattatatacgtgaaatagatgaatacgaaaagaga
aaacttgaatttgaattgatgggggtacttgaatctcctagattttgtatactaaagcag
tttatttcattaccagatggtttaaagtttcttgttgacatgagggctgatgtcatgcaa
ttacgagataaaaatcagcaatttttctctttagaaaaagatttaagaaatattctttct
tattggtttgatattggacttttggatttgcaccaaattacatgggattctcctgcttct
ttgttagaaaagcttattttgtatgaggcagtacatgcaatttcttcatgggatgattta
cgtgatagattggattcagatcgtagatgtttttccttttttcactataaaatgttgaat
gacccattgatttttgtagaagtagcacttgttgatgaaatggccagtagcatacaaaca
ttattggattctcatgttcctccaaaagatcctaaggatgccaaagtggcgattttttat
tcgatatcaaatactcaacgggggctttctgggattagtttaggtaattttctaataaag
cgagttgtaggtaagttatcggaagagtttcaaaatataaaaacttatgcaacattgtca
ccgatacctggttttgtaaaatggcttacaaaatcgttaagtatggataatattggattt
ttaaatgaacttaaaattactatgtctgtagatgaaataatatttcatcttaatgagaag
aattattctagtttttctcaagatctaaaaggattatttctaaagttatgtgcttattac
ttagtagaatctaagaataatgataaagcattggatccagtagcacattttcatttaagt
aatggagcgattataaagaaattaaactggatggctgatacttcagagaaagggttaaac
tgttctatgggtattatggtaaattatcattatgagttatcaagaatagatgataactat
gaagattatctagtaaatagaaaaattaattattcaaaagaagtgttgtcactattgaag
cgttga

DBGET integrated database retrieval system