KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_04120Help
Entry
ERGA_CDS_04120    CDS       T00232                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERGA_CDS_04120 (tpiA)
   01230 Biosynthesis of amino acids
    ERGA_CDS_04120 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERGA_CDS_04120 (tpiA)
   00051 Fructose and mannose metabolism
    ERGA_CDS_04120 (tpiA)
   00562 Inositol phosphate metabolism
    ERGA_CDS_04120 (tpiA)
Enzymes [BR:erg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ERGA_CDS_04120 (tpiA)
Exosome [BR:erg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ERGA_CDS_04120 (tpiA)
  Exosomal proteins of bladder cancer cells
   ERGA_CDS_04120 (tpiA)
  Exosomal proteins of melanoma cells
   ERGA_CDS_04120 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
682740..683462
Genome map
AA seq 240 aa AA seqDB search
MSLLIVANWKMHGDFFTFSSFTKELSNRLINIEDKVKVVLCPPFIALSTYVNCPHNIKFG
GQNCCYVSSGKYTGEISASMLYNSGCSYVIVGHSERRSTFHETDHDVRLKAECAIESGLI
PIICVGETLLDRENGMLKDTLLSQCSKSFPKNGKFIIAYEPVWAIGNNKIPSTDVIIEAL
EIIRSYDYVSDIIYGGAVNHTNVGDIVSINQLSGVLVGSASLDMESFFNIICSAINVGQS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcattactcatcgttgctaactggaagatgcatggtgatttttttactttttcttcg
tttacaaaggagcttagtaaccgtttaattaatatagaagataaagtaaaggtagtatta
tgcccaccatttattgcgttatctacttatgttaattgtccacataatattaagtttggt
ggacagaactgttgttatgtatctagtgggaagtacactggagaaattagtgctagtatg
ttatataactctggatgtagttatgtaatagtgggtcactctgaaaggaggagtacgttt
catgaaactgatcatgatgttaggttaaaagctgaatgtgcgatcgaatcaggattaata
ccaattatttgtgttggagaaactttactagatagggaaaatggtatgctaaaagatact
ttattaagtcaatgtagtaaatcttttcctaaaaatggtaagtttatcatagcatatgag
ccagtatgggcaatagggaacaataaaataccttctactgatgtaataatagaagcttta
gagattattaggtcatatgattatgtatctgatatcatatatggtggagcagtaaatcat
actaatgtaggtgatattgtcagtataaatcaattatctggtgttttagttggtagtgct
agtttagatatggagagtttttttaatataatatgtagtgctataaatgtggggcaaagt
taa

DBGET integrated database retrieval system