KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_04870Help
Entry
ERGA_CDS_04870    CDS       T00232                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
erg00900  Terpenoid backbone biosynthesis
erg01100  Metabolic pathways
erg01110  Biosynthesis of secondary metabolites
erg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERGA_CDS_04870 (dxr)
Enzymes [BR:erg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ERGA_CDS_04870 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NmrA 3Beta_HSD Semialdhyde_dh FTH NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CAI27939
UniProt: Q5FHA4
Position
complement(789562..790725)
Genome map
AA seq 387 aa AA seqDB search
MKTVSIFGSTGAIGQMIIDVILASSDSYQVKALVAKSNVQLLAFQAKVVNAEMVVIADVG
LYKELKDLLFGTNVKISVGDVGMQMAASLNVDYVMMAIVGIAALVPMVYLISAGVKVIAL
ANKESVVCGGTLLFNLAREKNVNIIPVDSEHNAIFQILHSNDRENIDKITITGSGGALLY
MDHDQMRNITVQETIKHPVWKMGKKISIDSATMVNKSLEIIEAYHLFSVKSEKLDVIIHP
EAIVHGIVSYVDGACIAFMSVPDMKISIMYTLSWPNRMSMLYKKLNLASYHQLTFMKPDI
NKFPGIRLGFEILRTSNIHANSIIFNTANEVAVDAFLNRKIGFLDIVNVIYSTLDMVDCL
HINSLSDILECDSIARRVASDIICKLN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacagtttctatatttggttcgaccggagctattggtcagatgataattgatgtg
atacttgctagttctgatagttatcaagtaaaagcattggttgcaaagtcaaacgttcaa
ttactagcatttcaagctaaggtagttaatgctgaaatggtggttattgcagatgttggt
ttatataaagaattaaaggatttattatttggtactaatgttaaaattagtgttggtgat
gttgggatgcaaatggcagcatcattgaatgtggattatgttatgatggctattgtagga
atagctgcacttgtacctatggtatatttgattagtgccggtgttaaagttattgccttg
gcaaacaaagaaagtgttgtttgtggtggaacattattatttaatttagcaagagaaaaa
aatgttaatattattcctgtagattcagaacataatgctatatttcaaatacttcatagt
aatgacagagaaaacatagataagattactattactggatctggtggtgcattattatat
atggatcatgatcaaatgcgaaatataacagttcaggaaacaataaaacatccagtttgg
aaaatgggtaaaaagatttccattgatagtgcaactatggttaataaatctcttgaaatt
atagaagcttatcatttgttttcagtaaaatcagaaaaattagatgtaattatacatcct
gaagcgatagtgcatggtatagtatcttatgtagatggtgcttgtattgcttttatgtct
gttcctgatatgaaaatttcaattatgtacacattgtcctggccaaatagaatgtctatg
ttgtataaaaagttgaatttggcatcataccatcagttaacatttatgaaacctgatatt
aacaagtttcctggaataagattaggttttgaaattcttagaacatcaaatattcatgca
aatagtattatttttaatactgctaatgaagttgcagttgatgcttttttaaatagaaaa
ataggatttcttgatattgtgaatgtgatttatagtacattagatatggttgactgtttg
catattaattccttatcagatattctggaatgtgattctatagcaagaagggttgcatct
gatatcatttgtaaattgaattag

DBGET integrated database retrieval system