KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_04870Help
Entry
ERGA_CDS_04870    CDS       T00232                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:erg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(789562..790725)
Genome map
AA seq 387 aa AA seqDB search
MKTVSIFGSTGAIGQMIIDVILASSDSYQVKALVAKSNVQLLAFQAKVVNAEMVVIADVG
LYKELKDLLFGTNVKISVGDVGMQMAASLNVDYVMMAIVGIAALVPMVYLISAGVKVIAL
ANKESVVCGGTLLFNLAREKNVNIIPVDSEHNAIFQILHSNDRENIDKITITGSGGALLY
MDHDQMRNITVQETIKHPVWKMGKKISIDSATMVNKSLEIIEAYHLFSVKSEKLDVIIHP
EAIVHGIVSYVDGACIAFMSVPDMKISIMYTLSWPNRMSMLYKKLNLASYHQLTFMKPDI
NKFPGIRLGFEILRTSNIHANSIIFNTANEVAVDAFLNRKIGFLDIVNVIYSTLDMVDCL
HINSLSDILECDSIARRVASDIICKLN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacagtttctatatttggttcgaccggagctattggtcagatgataattgatgtg
atacttgctagttctgatagttatcaagtaaaagcattggttgcaaagtcaaacgttcaa
ttactagcatttcaagctaaggtagttaatgctgaaatggtggttattgcagatgttggt
ttatataaagaattaaaggatttattatttggtactaatgttaaaattagtgttggtgat
gttgggatgcaaatggcagcatcattgaatgtggattatgttatgatggctattgtagga
atagctgcacttgtacctatggtatatttgattagtgccggtgttaaagttattgccttg
gcaaacaaagaaagtgttgtttgtggtggaacattattatttaatttagcaagagaaaaa
aatgttaatattattcctgtagattcagaacataatgctatatttcaaatacttcatagt
aatgacagagaaaacatagataagattactattactggatctggtggtgcattattatat
atggatcatgatcaaatgcgaaatataacagttcaggaaacaataaaacatccagtttgg
aaaatgggtaaaaagatttccattgatagtgcaactatggttaataaatctcttgaaatt
atagaagcttatcatttgttttcagtaaaatcagaaaaattagatgtaattatacatcct
gaagcgatagtgcatggtatagtatcttatgtagatggtgcttgtattgcttttatgtct
gttcctgatatgaaaatttcaattatgtacacattgtcctggccaaatagaatgtctatg
ttgtataaaaagttgaatttggcatcataccatcagttaacatttatgaaacctgatatt
aacaagtttcctggaataagattaggttttgaaattcttagaacatcaaatattcatgca
aatagtattatttttaatactgctaatgaagttgcagttgatgcttttttaaatagaaaa
ataggatttcttgatattgtgaatgtgatttatagtacattagatatggttgactgtttg
catattaattccttatcagatattctggaatgtgattctatagcaagaagggttgcatct
gatatcatttgtaaattgaattag

DBGET integrated database retrieval system