KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_05530Help
Entry
ERGA_CDS_05530    CDS       T00232                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ERGA_CDS_05530
Enzymes [BR:erg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ERGA_CDS_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
902305..903048
Genome map
AA seq 247 aa AA seqDB search
MESPLMKSLLVTRPQEDSIIIKETLTNLGFNIYIEPMFSIKYLPVKLNLEYFDLIISTSK
HSIIALSKISKNRTQPIITVGDNTKQVAEKLGFSSVTSLNGNIHDIISYIHNNSHLKFLY
IRGQEITYDLKEIFSNNTIKFYEIILYSTIDKQSLSNHCYKLLFHNRISGILFYSSRTAT
IFMDLIKKHNIGHKTSSITVYAMSQKIAETVNNISWKSIKTSDKPTNKSLISLISSDMKI
IKESTLD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggaatcaccattaatgaagtctttattagttacacgacctcaggaagactctataata
ataaaagaaaccttaacaaacttaggctttaatatttacatagagcctatgttttcaata
aaatatttacctgtaaagcttaatttagaatatttcgatttaattatatctacaagcaaa
cacagtattattgcattatctaaaattagtaaaaatcgcactcaacccataattaccgta
ggtgataacacaaagcaagttgcagaaaaattaggcttttcatcagtcacatcacttaac
ggtaatattcatgacatcatatcatacatacacaacaattctcatctaaaatttttatat
atcagaggacaagaaataacatatgacctaaaagagatttttagtaataacactattaaa
ttttatgaaattatactatattcgacaatagataaacagtctttaagtaatcattgctat
aagttactctttcataatagaatttctgggatattattctactcttcaagaactgccacc
atatttatggatttaataaaaaagcacaatataggtcataaaacaagcagtataactgta
tatgctatgagtcaaaaaatcgcagaaactgtaaataatatatcctggaaaagtataaaa
acttctgataaacccactaataaatcactcatttcattaatatcttctgatatgaaaatt
atcaaagaatccacattagactaa

DBGET integrated database retrieval system